KEGG   Homo sapiens (human): 55181Help
Entry
55181             CDS       T01001                                 

Gene name
SMG8, C17orf71
Definition
(RefSeq) SMG8, nonsense mediated mRNA decay factor
  KO
K18734  
protein SMG8
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     55181 (SMG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 991 aa AA seqDB search
MAGPVSLRDLLMGASAWMGSESPGGSPTEGGGSAAGGPEPPWREDEICVVGIFGKTALRL
NSEKFSLVNTVCDRQVFPLFRHQDPGDPGPGIRTEAGAVGEAGGAEDPGAAAGGSVRGSG
AVAEGNRTEAGSQDYSLLQAYYSQESKVLYLLLTSICDNSQLLRACRALQSGEAGGGLSL
PHAEAHEFWKHQEKLQCLSLLYLFSVCHILLLVHPTCSFDITYDRVFRALDGLRQKVLPL
LKTAIKDCPVGKDWKLNCRPCPPRLLFLFQLNGALKVEPPRNQDPAHPDKPKKHSPKRRL
QHALEDQIYRIFRKSRVLTNQSINCLFTVPANQAFVYIVPGSQEEDPVGMLLDQLRSHCT
VKDPESLLVPAPLSGPRRYQVMRQHSRQQLSFHIDSSSSSSSGQLVDFTLREFLWQHVEL
VLSKKGFDDSVGRNPQPSHFELPTYQKWISAASKLYEVAIDGKEEDLGSPTGELTSKILS
SIKVLEGFLDIDTKFSENRCQKALPMAHSAYQSNLPHNYTMTVHKNQLAQALRVYSQHAR
GPAFHKYAMQLHEDCYKFWSNGHQLCEERSLTDQHCVHKFHSLPKSGEKPEADRNPPVLY
HNSRARSTGACNCGRKQAPRDDPFDIKAANYDFYQLLEEKCCGKLDHINFPVFEPSTPDP
APAKNESSPAPPDSDADKLKEKEPQTQGESTSLSLALSLGQSTDSLGTYPADPQAGGDNP
EVHGQVEVKTEKRPNFVDRQASTVEYLPGMLHSNCPKGLLPKFSSWSLVKLGPAKSYNFH
TGLDQQGFIPGTNYLMPWDIVIRTRAEDEGDLDTNSWPAPNKAIPGKRSAVVMGRGRRRD
DIARAFVGFEYEDSRGRRFMCSGPDKVMKVMGSGPKESALKALNSDMPLYILSSSQGRGL
KPHYAQLMRLFVVVPDAPLQIILMPQVQPGPPPCPVFYPEKQEITLPPDGLWVLRFPYAY
VTERGPCFPPKENVQLMSYKVLRGVLKAVTQ
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcccgtgagcttgcgagaccttctaatgggagcatcagcctggatgggctct
gaaagtcccggagggtcccctactgagggcggagggagcgcggctggcggaccggagcct
ccatggcgggaggatgagatctgcgttgtgggaatcttcggcaagacggctctacgcctg
aattccgagaagttctctcttgtgaatacggtgtgcgaccgacaggtctttcctctcttt
cgccaccaagatcctggggatccaggacctggaatcagaactgaggctggcgccgtgggt
gaggccggtggagccgaggaccctggggctgcagccgggggttcagttcggggaagtgga
gctgtcgcggaaggtaaccgaactgaggcaggctcccaggactacagccttctgcaggcc
tactacagtcaggaaagcaaagttctgtatcttctcctcacctccatctgtgacaattca
cagcttctccgggcttgtcgggctcttcagagcggggaagctggaggtggactctcttta
cctcatgcagaagcacacgagttctggaagcatcaagagaagctgcagtgcctcagtctc
ctttacctattctctgtctgtcatatcttgcttctggtccatcccacttgttcctttgat
atcacttatgatcgagtattcagagccctggatgggctgagacagaaggtcctgccgctc
cttaaaacagccattaaggattgtccagttggcaaagactggaagctaaactgccgacct
tgcccacctagactccttttcctctttcaactcaatggagccctcaaggtagaacctcct
cggaaccaagacccagctcatccagacaagcccaagaaacattctcccaaaaggaggctg
cagcatgccctggaggaccagatctatagaatcttccggaagagtcgtgtcttgactaat
cagagcatcaactgcctctttactgtgcctgccaaccaagctttcgtgtacatagtaccg
ggaagccaggaggaggacccagtaggtatgttgctggaccaacttaggagtcattgtact
gtgaaggacccggaatctttgctggtgcctgcacccctttctgggcctaggcgataccag
gtgatgaggcagcacagccgacaacaactttcctttcacattgacagcagcagttccagt
tcttcaggccagctagtggatttcactcttcgggaattcctatggcagcatgtggagcta
gttctaagcaagaaaggtttcgatgacagtgtgggcaggaacccacagccttcccatttt
gaacttcctacttatcagaagtggatctcagcagcttcaaaactgtatgaggtggctatt
gatgggaaagaagaggacttggggtcacccactggagagctaacatctaagattttaagc
agtattaaagtcttggaaggatttttggatattgacacaaaattctcagaaaaccgatgc
caaaaagctttacccatggcccacagtgcctaccagtcaaatttgcctcataattacaca
atgactgtccataagaatcagcttgcccaggctcttcgagtgtacagtcaacatgctaga
ggtccagcatttcacaaatacgccatgcagttacatgaggactgctacaaattttggagc
aatggccatcagctctgtgaggagaggagtttaactgatcaacactgtgtgcacaaattt
cactcattacctaaatcaggagaaaaaccagaggctgatagaaatccgcctgtgctatat
cacaatagccgagctcgatctactggtgcttgcaactgtggaaggaaacaagcacctcga
gatgatccctttgatatcaaagcagccaattatgacttctatcagcttctggaagaaaag
tgttgtggaaaattggatcatatcaatttcccagtatttgaaccaagtactccagatcct
gctcctgctaaaaatgaatcctctcctgctcctccagattcggatgctgataaacttaaa
gaaaaagaacctcaaacccaaggagagagcacgagcctgagtttagctttgagtttgggc
caatccacagatagcttaggtacctatccagctgatccacaagcaggaggagataatcca
gaagttcatggtcaagtagaagtgaaaactgagaagaggccaaacttcgttgatcgacag
gcatccacagttgagtatctcccaggcatgctacattcaaattgccctaaaggtctccta
cccaaattctccagctggtctttggttaaactaggccctgctaagtcttataactttcat
acaggtttggaccaacagggctttattccaggaacaaattatcttatgccttgggacatt
gtcatcaggactagagctgaagatgaaggagacttagacacaaactcttggcctgctcca
aataaagctattcctggaaagagaagtgcggttgtaatgggaagaggaagacggcgagat
gacatagctcgagcttttgtgggctttgaatatgaagactctcgaggtcggagattcatg
tgctctgggcctgacaaagtaatgaaagtaatgggaagtgggccaaaggaatcagcttta
aaagccctaaatagtgacatgcccttatatattctgtcatcctctcaaggtagagggctg
aaacctcattatgctcaacttatgaggctttttgttgtggttcctgatgctcctttgcag
ataatactaatgcctcaggttcagccaggcccaccaccatgtccggtattctacccagaa
aaacaagaaatcacccttccacctgatggcctttgggttttgagatttccttatgcatat
gtgactgagagaggaccttgtttcccccctaaggaaaatgtgcagttaatgagctacaag
gtgctccgtggggttcttaaggcagtaacacaataa

DBGET integrated database retrieval system