KEGG   Homo sapiens (human): 55197Help
Entry
55197             CDS       T01001                                 

Gene name
RPRD1A, HsT3101, P15RS
Definition
(RefSeq) regulation of nuclear pre-mRNA domain containing 1A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q12.2
AA seq 312 aa AA seqDB search
MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKAKPNRKLTFL
YLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYEND
VLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRALQDLENAASGD
AAVHQRIASLPVEVQEVSLLDKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQL
TRMLADFLRCQKEALAEKEHKLEEYKRKLARVSLVRKELRSRIQSLPDLSRLPNVTGSHM
HLPFAGDIYSED
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccttctctgaggcggcgctggagaagaagctgtcggagttgagcaactcgcag
cagagcgtgcagaccttgtccctgtggctcattcaccaccgtaaacactcgcgtcccatc
gtcaccgtgtgggagcgggagctgcggaaagccaaaccaaacaggaagcttacttttctc
tacctagccaatgatgtcatacagaacagcaagaggaaggggccagagtttacaaaagat
tttgcaccagttatagtggaggcttttaagcatgtttcaagtgaaactgatgaaagttgt
aagaagcaccttggaagagtgttatctatttgggaagaaaggtctgtttatgaaaatgat
gtattagaacaacttaaacaagctctgtatggtgataagaagcctaggaagcgaacttat
gaacagataaaggtggatgaaaatgaaaactgttcctctctgggatctccaagtgaacca
ccacagactctagatctcgttagagcattacaagatctggaaaatgcagcctcaggtgat
gcagcagttcatcagaggatagcttctttacctgttgaagtccaagaagtatctctatta
gataaaataacagataaagaatctggagaaaggctttccaaaatggtagaggatgcgtgt
atgttgctggcagattacaatggcagattggcggcagaaatagatgatagaaagcaactc
actcgaatgttagcagattttcttcgttgtcaaaaggaagcccttgcagagaaagagcat
aaattggaagagtacaagcgcaagctagccagagtttccctggtgcgcaaagaactcagg
tcccggatccagagcctgccagacttatctcgattgcccaatgtcactggcagccacatg
cacctgccctttgcgggagacatctacagtgaagattga

DBGET integrated database retrieval system