KEGG   Homo sapiens (human): 55217Help
Entry
55217             CDS       T01001                                 

Gene name
TMLHE, AUTSX6, BBOX2, TMLD, TMLH, TMLHED, XAP130
Definition
trimethyllysine hydroxylase, epsilon (EC:1.14.11.8)
Orthology
K00474  
trimethyllysine dioxygenase [EC:1.14.11.8]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    55217 (TMLHE)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.8  trimethyllysine dioxygenase
     55217 (TMLHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 376 aa AA seqDB search
MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHF
ELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTW
PDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKF
LQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALD
RHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHE
YIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTY
RHFVSGTSIEHRGSLI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtggtaccacagattgtcccacctacacagcaggcttcaggacttgctgaagggagga
gtcatatatccggcccttccacagcccaacttcaaaagcttacttcctttagctgtccat
tggcaccatacagcctccaagtctctgacttgtgcttggcagcaacatgaagatcatttt
gagctgaaatatgctaataccgtgatgcgctttgattacgtctggcttcgagaccactgc
cgctcagcatcgtgctacaactctaagactcaccagcgcagcctggatactgccagtgtg
gatttatgtatcaagccaaagaccattcgtctggatgagaccacactctttttcacttgg
ccagatggtcatgtgactaaatatgatttgaattggctggtgaaaaacagctatgaaggg
cagaaacaaaaagtcatccagcctagaatactatggaatgctgaaatctaccagcaagcc
caagttccatcggtagattgccagagcttcttagaaaccaacgagggactgaagaagttt
ctgcaaaactttctgctctatggaattgcattcgtagaaaatgtccctcccactcaagag
cacacagagaagttggcagaaaggatcagcttaatcagagaaaccatttatgggaggatg
tggtatttcacttcagacttctccagaggtgacactgcgtacaccaagctagctctggat
cggcacactgacactacctattttcaagagccctgtggcattcaagtgtttcattgtctt
aaacatgaaggaactggtggcaggacactgctagtagatggattctatgcagcagaacag
gtacttcaaaaggcacctgaggaatttgaactcctcagtaaagtgccattgaagcatgaa
tatattgaagatgttggagaatgtcacaaccacatgattgggattgggccagtcttaaat
atctacccatggaataaagagctgtatttgatcagattattcaaagaaaaacaaaacacg
gtcaacaggcagtggaactcctcactccaatgtgatattcctgagagaatattgacttat
cgtcacttcgtctctgggacaagtattgaacataggggaagccttatataa

DBGET integrated database retrieval system