KEGG   Homo sapiens (human): 55219Help
Entry
55219             CDS       T01001                                 

Gene name
MACO1, MACOILIN, TMEM57
Definition
(RefSeq) macoilin 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Macoilin Reo_sigmaC DUF812 GLE1
Motif
Other DBs
NCBI-GeneID: 55219
NCBI-ProteinID: NP_060672
OMIM: 610301
HGNC: 25572
Ensembl: ENSG00000204178
Vega: OTTHUMG00000003473
Pharos: Q8N5G2(Tbio)
UniProt: Q8N5G2
Position
1p36.11
AA seq 664 aa AA seqDB search
MKRRNADCSKLRRPLKRNRITEGIYGSTFLYLKFLVVWALVLLADFVLEFRFEYLWPFWL
FIRSVYDSFRYQGLAFSVFFVCVAFTSNIICLLFIPIQWLFFAASTYVWVQYVWHTERGV
CLPTVSLWILFVYIEAAIRFKDLKNFHVDLCRPFAAHCIGYPVVTLGFGFKSYVSYKMRL
RKQKEVQKENEFYMQLLQQALPPEQQMLQKQEKEAEEAAKGLPDMDSSILIHHNGGIPAN
KKLSTTLPEIEYREKGKEKDKDAKKHNLGINNNNILQPVDSKIQEIEYMENHINSKRLNN
DLVGSTENLLKEDSCTASSKNYKNASGVVNSSPRSHSATNGSIPSSSSKNEKKQKCTSKS
PSTHKDLMENCIPNNQLSKPDALVRLEQDIKKLKADLQASRQVEQELRSQISSLSSTERG
IRSEMGQLRQENELLQNKLHNAVQMKQKDKQNISQLEKKLKAEQEARSFVEKQLMEEKKR
KKLEEATAARAVAFAAASRGECTETLRNRIRELEAEGKKLTMDMKVKEDQIRELELKVQE
LRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQI
LQKDQEIKDLKQKIAEVMAVMPSITYSAATSPLSPVSPHYSSKFVETSPSGLDPNASVYQ
PLKK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcggaacgccgactgcagtaagctccgccgccccctaaagcggaaccggatc
accgagggcatttacggcagtacatttttatacctgaaattcctggtggtgtgggcactt
gtcctcctagcagattttgtcctggagttcagatttgaatacctgtggccattctggctt
ttcatcagaagcgtctatgattccttcagataccagggactggccttctcagtatttttt
gtttgtgtagcattcacgtcaaatataatatgcctgctgttcatccccatacagtggctt
ttttttgctgctagcacatatgtatgggttcagtacgtatggcacacagaaaggggagtg
tgtttgcctacagtgtctctctggatcctctttgtttatattgaagcagccattagattt
aaagatctcaaaaactttcatgtagacctttgtcgtccatttgctgctcactgtattggg
taccctgtggtaactttggggtttggcttcaaaagttacgtaagctacaaaatgcggtta
aggaagcaaaaagaagtacaaaaagagaacgagttttacatgcaacttcttcaacaagct
ctccctccagagcaacagatgctacagaagcaagaaaaagaggccgaggaagcagccaaa
ggattacctgatatggattcttcgatccttatacaccacaatggaggtatcccagccaac
aaaaaactctccacaactttgccagagatagaataccgagaaaaagggaaagaaaaggac
aaggatgccaaaaaacacaaccttggaataaataacaacaatattctacaacctgtagac
tctaaaatacaagagattgagtatatggaaaaccatatcaatagtaaaagattaaataat
gatcttgtgggaagtacagaaaatctcttgaaagaggactcatgcactgcttcctcaaaa
aattacaaaaatgccagtggagttgtgaactcttcacctcgaagtcatagcgccacaaat
gggagcattccttcctcatctagtaaaaatgagaagaagcagaaatgcactagcaagagc
ccaagtacacacaaggacttaatggaaaactgtattcctaataaccagctaagcaaacca
gacgcactggtcaggctggaacaagacattaaaaagttaaaggctgacctgcaagccagc
agacaagtggaacaagagctccgcagtcagatcagctccctttcgagcaccgagcgaggg
atccgctcagaaatgggccagcttcggcaggagaacgagctgctgcagaacaagttacat
aatgctgtgcaaatgaagcaaaaagacaagcagaatatcagccagttggagaaaaagcta
aaagctgagcaggaagcccgaagttttgtagagaaacagttaatggaagagaaaaagagg
aagaagttagaagaagccactgctgcccgggctgttgcgtttgctgctgcatctagggga
gaatgcaccgaaaccttacggaatcggatcagagaactagaagcagagggcaagaagctc
acgatggacatgaaggtgaaagaagaccaaatcagagaactagaactaaaagtccaggag
cttcggaaatataaggaaaatgagaaggacactgaggtgttaatgtcagccctctcagcc
atgcaagacaaaacacagcacctggagaacagcttaagtgcagagacgagaatcaagctg
gacctgttctccgcactgggcgatgcaaagcggcagctcgagattgcccaaggacaaatc
cttcagaaagatcaggaaatcaaggacctaaaacagaagatagccgaagtcatggccgtc
atgcccagcataacatacagtgccgccaccagccccctgagccctgtttccccccactac
tcttccaaatttgtggagaccagcccctctggacttgaccccaatgcctctgtttaccag
cccctgaagaaatga

DBGET integrated database retrieval system