KEGG   Homo sapiens (human): 55226Help
Entry
55226             CDS       T01001                                 

Gene name
NAT10, ALP, Kre33, NET43
Definition
(RefSeq) N-acetyltransferase 10
  KO
K14521  N-acetyltransferase 10 [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55226 (NAT10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     55226 (NAT10)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    55226 (NAT10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GNAT_acetyltr_2 tRNA_bind_2 Helicase_RecD DUF1726 Acetyltransf_7 Acetyltransf_1 Focal_AT
Motif
Other DBs
NCBI-GeneID: 55226
NCBI-ProteinID: NP_078938
OMIM: 609221
HGNC: 29830
Ensembl: ENSG00000135372
Vega: OTTHUMG00000166249
Pharos: Q9H0A0(Tbio)
UniProt: Q9H0A0
Position
11p13
AA seq 1025 aa AA seqDB search
MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYK
KELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGM
CVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVV
GRFNERFILSLASCKKCLVIDDQLNILPISSHVATMEALPPQTPDESLGPSDLELRELKE
SLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAALGLAIAG
AVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNV
FREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTG
RSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTLHEVSLQESIRYAPGDAVEKW
LNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKN
SPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKA
SGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLE
EKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLL
KFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLS
YQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMD
MIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIR
KVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDL
SEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMK
LKRKK
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggaaaaaggtggataaccgaatccggattctcattgagaatggagtagctgag
cggcaaagatctctctttgttgtagttggggatcgaggaaaagatcaggtggtaatactt
catcacatgttatccaaagcaactgtgaaggctcggccttcagtgctgtggtgttataag
aaagagctggggtttagcagtcaccggaagaaaagaatgcgacagctgcagaagaaaata
aagaatggaacactgaacataaagcaggacgacccctttgaactcttcatagcagccaca
aacattcgctactgctactacaacgagacccacaagatcctgggcaataccttcggcatg
tgtgtgctgcaggattttgaagccttaactccaaacttgctggccaggactgtagaaaca
gtggaaggtggtgggctagtggtcatcctcctacggaccatgaactcactcaagcaattg
tacacagtgactatggatgtgcattccaggtacagaactgaggcccatcaggatgtggtg
ggaagatttaatgaaaggtttattctgtctctggcctcttgtaagaagtgtctcgtcatt
gatgaccagctcaacatcctgcccatctcctcccacgttgccaccatggaggccctgcct
ccccagactccggatgagagtcttggtccttctgatctggagctgagggagttgaaggag
agcttgcaggacacccagcctgtgggtgtgttggtggactgctgtaagactctagaccag
gccaaagctgtcttgaaatttatcgagggcatctctgaaaagaccctgaggagtactgtt
gcactcacagctgctcgaggacggggaaaatctgcagccctgggattggcgattgctggg
gcggtggcatttgggtactccaatatctttgttacctccccaagccctgataacctccat
actctgtttgaatttgtatttaaaggatttgatgctctgcaatatcaggaacatctggat
tatgagattatccagtctctaaatcctgaatttaacaaagcagtgatcagagtgaatgta
tttcgagaacacaggcagactattcagtatatacatcctgcagatgctgtgaagctgggc
caggctgaactagttgtgattgatgaagctgccgccatccccctccccttggtgaagagc
ctacttggcccctaccttgttttcatggcatccaccatcaatggctatgagggcactggc
cggtcactgtccctcaagctaattcagcagctccgtcaacagagcgcccagagccaggtc
agcaccactgctgagaataagaccacgacgacagccagattggcatcagcgcggacactg
catgaggtttccctccaggagtcaatccgatacgcccctggggatgcagtggagaagtgg
ctgaatgacttgctgtgcctggattgcctcaacatcactcggatagtctcaggctgcccc
ttgcctgaagcttgtgaactgtactatgttaatagagataccctcttttgctaccacaag
gcctctgaagttttcctccaacggcttatggccctctacgtggcttctcactacaagaac
tctcccaatgatctccagatgctctccgatgcacctgctcaccatctcttctgccttctg
cctcctgtgccccccacccagaatgcccttccagaagtgcttgctgttatccaggtgtgc
cttgaaggggagatttctcgccagtccatcttgaacagtctgtctcgaggcaagaaggct
tcaggggacctgattccatggacagtgtcagaacagttccaagatccagactttggtggt
ctgtctggtggaagggtcgttcgcattgctgttcacccagattatcaagggatgggctat
ggcagccgtgctctgcagctgctgcagatgtactatgaaggcaggtttccttgtctggag
gaaaaggtccttgagacaccacaggaaattcacaccgtaagcagcgaggctgtcagcttg
ttggaagaggtcatcactccccggaaggacctgcctcctttactcctcaaattgaatgag
aggcctgccgaacgcctggattacctgggtgtttcctatggcttgacccccaggctcctc
aagttctggaaacgagctggatttgttcctgtttatctgagacagaccccgaatgacctg
accggagagcactcgtgcatcatgctgaagacgctcactgatgaggatgaggctgaccag
ggaggctggcttgcagccttctggaaagatttccgacggcggttcctagccttgctctcc
taccagttcagtaccttctctccttccctggctctgaacatcattcagaacaggaacatg
gggaagccagcccagcctgccctgagccgggaggagctggaagcactcttcctcccctat
gacctgaagcggctggagatgtattcacggaatatggtggactatcacctcatcatggac
atgatcccggccatctctcgcatctatttcctgaaccagctgggggacctggccctgtct
gcggctcagtcggctcttctcttggggattggcctgcagcataagtctgtggaccagctg
gaaaaggagattgagctgccctcgggccagttgatgggacttttcaaccggatcatccgc
aaagttgtgaagctatttaatgaagttcaggaaaaggccattgaggagcagatggtggca
gcgaaggatgtggtcatggagcccacgatgaagaccctcagtgacgacctagatgaagca
gcaaaggaatttcaggagaaacacaagaaggaagtagggaagctgaagagcatggacctc
tctgaatacataatccgtggggacgatgaagagtggaatgaagttttgaacaaagctggg
ccgaacgcctcgatcatcagcctgaaaagtgacaagaaaaggaagttagaggccaaacaa
gaacccaaacagagcaagaagttgaagaacagagagacaaagaacaaaaaagatatgaaa
ctgaagcggaagaaatag

DBGET integrated database retrieval system