KEGG   Homo sapiens (human): 55240Help
Entry
55240             CDS       T01001                                 

Gene name
STEAP3, AHMIO2, STMP3, TSAP6, dudlin-2
Definition
STEAP family member 3, metalloreductase
Orthology
K10142  
metalloreductase STEAP3 [EC:1.16.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    55240 (STEAP3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     55240 (STEAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14.2
AA seq 488 aa AA seqDB search
MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRN
PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQ
EHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
MALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVCFYAYNFVRDVLQPYV
QESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ
HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIY
LSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHA
LAEKTSHV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagagatggacaagccactgatcagcctccacctggtggacagcgatagtagc
cttgccaaggtccccgatgaggcccccaaagtgggcatcctgggtagcggggactttgcc
cgctccctggccacacgcctggtgggctctggcttcaaagtggtggtggggagccgcaac
cccaaacgcacagccaggctgtttccctcagcggcccaagtgactttccaagaggaggca
gtgagctccccggaggtcatctttgtggctgtgttccgggagcactactcttcactgtgc
agtctcagtgaccagctggcgggcaagatcctggtggatgtgagcaaccctacagagcaa
gagcaccttcagcatcgtgagtccaatgctgagtacctggcctccctcttccccacttgc
acagtggtcaaggccttcaatgtcatctctgcctggaccctgcaggctggcccaagggat
ggtaacaggcaggtgcccatctgcggtgaccagccagaagccaagcgtgctgtctcggag
atggcgctcgccatgggcttcatgcccgtggacatgggatccctggcgtcagcctgggag
gtggaggccatgcccctgcgcctcctcccggcctggaaggtgcccaccctgctggccctg
gggctcttcgtctgcttctatgcctacaacttcgtccgggacgttctgcagccctatgtg
caggaaagccagaacaagttcttcaagctgcccgtgtccgtggtcaacaccacactgccg
tgcgtggcctacgtgctgctgtcactcgtgtacttgcccggcgtgctggcggctgccctg
cagctgcggcgcggcaccaagtaccagcgcttccccgactggctggaccactggctacag
caccgcaagcagatcgggctgctcagcttcttctgcgccgccctgcacgccctctacagc
ttctgcttgccgctgcgccgcgcccaccgctacgacctggtcaacctggcagtcaagcag
gtcttggccaacaagagccacctctgggtggaggaggaggtctggcggatggagatctac
ctctccctgggagtgctggccctcggcacgttgtccctgctggccgtgacctcactgccg
tccattgcaaactcgctcaactggagggagttcagcttcgttcagtcctcactgggcttt
gtggccctcgtgctgagcacactgcacacgctcacctacggctggacccgcgccttcgag
gagagccgctacaagttctacctgcctcccaccttcacgctcacgctgctggtgccctgc
gtcgtcatcctggccaaagccctgtttctcctgccctgcatcagccgcagactcgccagg
atccggagaggctgggagagggagagcaccatcaagttcacgctgcccacagaccacgcc
ctggccgagaagacgagccacgtatga

DBGET integrated database retrieval system