KEGG   Homo sapiens (human): 55247Help
Entry
55247             CDS       T01001                                 

Gene name
NEIL3, FGP2, FPG2, NEI3, hFPG2, hNEI3
Definition
nei endonuclease VIII-like 3 (E. coli) (EC:4.2.99.18)
Orthology
K10569  
endonuclease VIII-like 3
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hsa03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q34.3
AA seq 605 aa AA seqDB search
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDS
SQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLE
VQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDV
LMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGL
ALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQKENPQHVDICKLPTRNTIIS
WTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACDACLTSRPIDSVLKSEENSTVFS
HLMKYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNSP
PASVCLNDIQHPSKKTTNDITQPSSKVNISPTISSESKLFSPAHKKPKTAQYSSPELKSC
NPGYSNSELQINMTDGPRTLNPDSPRCSKHNRLCILRVVRKDGENKGRQFYACPLPREAQ
CGFFEWADLSFPFCNHGKRSTMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGIK
IIPGC
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaggaccaggctgtactctgaatggagagaagattcgcgcgcgggtgctcccg
ggccaggcggtgaccggcgtgcggggaagcgctctgcggagtctgcagggccgcgccttg
cggctcgcagcctccacggttgtggtctccccgcaggctgctgcactgaataatgattcc
agccagaatgtcttgagcctgtttaatggatatgtttacagtggcgtggaaactttgggg
aaggagctctttatgtactttggaccaaaagctttacggattcatttcggaatgaaaggc
ttcatcatgattaatccacttgagtataaatataaaaatggagcttctcctgttttggaa
gtgcagctcaccaaagatttgatttgtttctttgactcatcagtagaactcagaaactca
atggaaagccaacagagaataagaatgatgaaagaattagatgtatgttcacctgaattt
agtttcttgagagcagaaagtgaagttaaaaaacagaaaggccggatgctaggtgatgtg
ctaatggatcagaacgtattgcctggagtagggaacatcatcaaaaatgaagctctcttt
gacagtggtctccacccagctgttaaagtttgtcaattaacagatgaacagatccatcac
ctcatgaaaatgatacgtgatttcagcattctcttttacaggtgccgtaaagcaggactt
gctctctctaaacactataaggtttacaagcgtcctaattgtggtcagtgccactgcaga
ataactgtgtgccgctttggggacaataacagaatgacatatttctgtcctcactgtcaa
aaagaaaatcctcaacatgttgacatatgcaagctaccgactagaaatactataatcagt
tggacatctagcagggtggatcatgttatggactccgtggctcggaagtcggaagagcac
tggacctgtgtggtgtgtactttaatcaataagccctcttctaaggcatgtgatgcttgc
ttgacctcaaggcctattgattcagtgctcaagagtgaagaaaattctactgtctttagc
cacttaatgaagtacccgtgtaatacttttggaaaacctcatacagaagtcaagatcaac
agaaaaactgcatttggaactacaactcttgtcttgactgattttagcaataaatccagt
actttggaaagaaaaacaaagcaaaaccagatactagatgaggagtttcaaaactctcct
cctgctagtgtttgtttgaatgatatacagcacccctccaagaagacaacaaacgatata
actcaaccatccagcaaagtaaacatatcacctacaatcagttcagaatctaaattattt
agtccagcacataaaaaaccgaaaacagcccaatactcatcaccagagcttaaaagctgc
aaccctggatattctaacagtgaacttcaaattaatatgacagatggccctcgtacctta
aatcctgacagccctcgctgcagtaaacacaaccgcctctgcattctccgagttgtgagg
aaggatggggaaaacaagggcaggcagttttatgcctgtcctctacctagagaagcacaa
tgtggattttttgaatgggcagatttgtccttcccattctgcaaccatggcaagcgttcc
accatgaaaacagtattgaagattggacctaacaatggaaagaatttttttgtgtgtcct
cttgggaaggaaaaacaatgcaattttttccagtgggcagaaaatgggccaggaataaaa
attattcctggatgctaa

DBGET integrated database retrieval system