KEGG   Homo sapiens (human): 55256Help
Entry
55256             CDS       T01001                                 

Gene name
ADI1, APL1, ARD, Fe-ARD, MTCBP1, Ni-ARD, SIPL, mtnD
Definition
acireductone dioxygenase 1 (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    55256 (ADI1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     55256 (ADI1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     55256 (ADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p25.3
AA seq 179 aa AA seqDB search
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERN
YSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFME
KGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcctggtatatggacgacgccccgggcgacccgcggcaaccccaccgcccc
gaccccggccgcccagtgggcctggagcagctgcggcggctcggggtgctctactggaag
ctggatgctgacaaatatgagaatgatccagaattagaaaagatccgaagagagaggaac
tactcctggatggacatcataaccatatgcaaagataaactaccaaattatgaagaaaag
attaagatgttctacgaggagcatttgcacttggacgatgagatccgctacatcctggat
ggcagtgggtacttcgatgtgagggacaaggaggaccagtggatccggatcttcatggag
aagggagacatggtgacgctccccgcggggatctatcaccgcttcacggtggacgagaag
aactacacgaaggccatgcggctgtttgtgggagaaccggtgtggacagcgtacaaccgg
cccgctgaccattttgaagcccgcgggcagtacgtgaaatttctggcacagaccgcctag

DBGET integrated database retrieval system