KEGG   Homo sapiens (human): 55272Help
Entry
55272             CDS       T01001                                 

Gene name
IMP3, BRMS2, C15orf12, MRPS4
Definition
(RefSeq) IMP3, U3 small nucleolar ribonucleoprotein
  KO
K14560  
U3 small nucleolar ribonucleoprotein protein IMP3
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55272 (IMP3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    55272 (IMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NV31(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
15q24.2
AA seq 184 aa AA seqDB search
MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELAR
RLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRM
AQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDF
DLEA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggaagcttaagttccacgagcagaagctgctgaagcaggtggacttcctgaac
tgggaggtcaccgaccacaacctgcacgagctgcgcgtgctgcggcgttaccggctgcag
cggcgggaggactacacgcgctacaaccagctgagccgtgccgtgcgtgagctggcgcgg
cgcctgcgcgacctgcccgaacgcgaccagttccgcgtgcgcgcttcggccgcgctgctg
gacaagctgtatgctctcggcttggtgcccacgcgcggttcgctggagctctgcgacttc
gtcacggcctcgtccttctgccgccgccgcctccccaccgtgctcctcaagctgcgcatg
gcgcagcaccttcaggctgccgtggcctttgtggagcaagggcacgtacgcgtgggccct
gacgtggttaccgaccccgccttccttgtcacgcgcagcatggaggactttgtcacttgg
gtggactcgtccaagatcaagcggcacgtgctagagtacaatgaggagcgcgatgacttc
gatctggaagcctag

DBGET integrated database retrieval system