KEGG   Homo sapiens (human): 55274Help
Entry
55274             CDS       T01001                                 

Gene name
PHF10, BAF45A, XAP135
Definition
(RefSeq) PHD finger protein 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8WUB8(Tdark)
UniProt: 
Position
6q27
AA seq 498 aa AA seqDB search
MAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGSGDSSRSCETS
SQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGVTSFKRKYPDLERRDLSHKEK
LYLRELNVITETQCTLGLTALRSDEVIDLMIKEYPAKHAEYSVILQEKERQRITDHYKEY
SQMQQQNTQKVEASKVPEYIKKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKY
KVLPTERTKVSSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGD
SDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKAATPRKDGPKR
SVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIHCSQCENSGHPSCLDMTMELV
SMIKTYPWQCMECKTCIICGQPHHEEEMMFCDMCDRGYHTFCVGLGAIPSGRWICDCCQR
APPTPRKVGRRGKNSKEG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggccgggcccggggctgcgctgtccccgcggccgtgcgacagcgaccca
gccacccccggagcgcagtccccgaaggatgataatgaagataattcaaatgatgggacc
cagccatccaaaaggaggcgaatgggctcaggagatagttctaggagttgtgaaacttca
agtcaagatcttggttttagttactatccagcagaaaacttgatagagtacaaatggcca
cctgatgaaacaggagaatactatatgcttcaagaacaagtcagtgaatatttgggtgtg
acctcctttaaaaggaaatatccagatttagagcgacgagatttgtctcacaaggagaaa
ctctacctgagagagctaaatgtcattactgaaactcagtgcactctaggcttaacagca
ttgcgcagtgatgaagtgattgatttaatgataaaagaatatccagccaaacatgctgag
tattctgttattctacaagaaaaagaacgtcaacgaattacagaccattataaagagtat
tcccaaatgcaacaacagaatactcagaaagttgaagccagtaaagtgcctgagtatatt
aagaaagctgccaaaaaagcagcagaatttaatagcaacttaaaccgggaacgcatggaa
gaaagaagagcttattttgacttgcagacacatgttatccaggtacctcaagggaagtac
aaagttttgccaacagagcgaacaaaggtcagttcttacccagtggctctcatccccgga
cagttccaggaatattataagaggtactcaccagatgagctgcggtatctgccattaaac
acagccctgtatgagccccctctggatcctgagctccctgctctagacagtgatggtgat
tcagatgatggcgaagatggtcgaggtgatgagaaacggaaaaataaaggcacttcggac
agctcctctggcaatgtatctgaaggggaaagccctcctgacagccaggaggactctttc
cagggaagacagaaatcaaaagacaaagctgccactccaagaaaagatggtcccaaacgt
tctgtactgtccaagtcagttcctgggtacaagccaaaggtcattccaaatgctatatgt
ggaatttgtctgaagggtaaggagtccaacaagaaaggaaaggctgaatcacttatacac
tgctcccaatgtgagaatagtggccatccttcttgcctggatatgacaatggagcttgtt
tctatgattaagacctacccatggcagtgtatggaatgtaaaacatgcattatatgtgga
caaccccaccatgaagaagaaatgatgttctgtgatatgtgtgacagaggttatcatact
ttttgtgtgggccttggtgctattccatcaggtcgctggatttgtgactgttgtcagcgg
gcccccccaacacccaggaaagtgggcagaagggggaaaaacagcaaagagggataa

DBGET integrated database retrieval system