KEGG   Homo sapiens (human): 55283Help
Entry
55283             CDS       T01001                                 

Gene name
MCOLN3, TRP-ML3, TRPML3
Definition
(RefSeq) mucolipin 3
  KO
K04994  mucolipin 3
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPML (Mucolipin)
   55283 (MCOLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel Ion_trans
Motif
Other DBs
NCBI-GeneID: 55283
NCBI-ProteinID: NP_060768
OMIM: 607400
HGNC: 13358
Ensembl: ENSG00000055732
Vega: OTTHUMG00000009955
Pharos: Q8TDD5(Tbio)
UniProt: Q8TDD5
Structure
PDB: 

Jmol
Position
1p22.3
AA seq 553 aa AA seqDB search
MADPEVVVSSCSSHEEENRCNFNQQTSPSEELLLEDQMRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQS
DVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPE
IETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSL
ILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDILTIIGSILKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAA
MIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSRI
YLYSFISLFIYMILSLFIALITDTYETIKQYQQDGFPETELRTFISECKDLPNSGKYRLE
DDPPVSLFCCCKK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcctgaggtagttgtgagtagctgcagctctcatgaagaggaaaatcgctgc
aattttaaccagcaaacatctccatctgaggagcttctattagaagaccagatgaggcga
aaactcaaattttttttcatgaatccctgtgagaagttctgggctcgaggtagaaaacca
tggaaacttgccatacaaattctaaaaattgcaatggtgactatccagctggtcttattt
gggctaagtaaccagatggtggtagctttcaaggaagagaatactatagcattcaaacac
cttttcctaaaaggatatatggaccgaatggatgacacatatgcagtgtacacacaaagt
gacgtgtatgatcagttaatcttcgcagtaaaccagtacttgcagctatacaatgtctcc
gttgggaatcatgcttatgagaacaaaggtaccaagcaatctgctatggcaatctgtcag
cacttctacaagcgaggaaacatctaccctggaaatgatacctttgacatcgatccagaa
attgaaactgagtgtttctttgtggagccagatgaaccttttcacattgggacaccagca
gaaaataaactgaacttaacactggacttccacagactcctaacagtggagcttcagttt
aaactgaaagccattaatctgcagacagttcgtcatcaagaactccctgactgttatgac
tttactctgactataacatttgacaacaaggcccatagtggaagaattaaaataagttta
gataatgacatttccatcagagaatgtaaagactggcatgtatctggatcaattcagaag
aacactcattacatgatgatctttgatgcctttgtcattctgacttgcttggtttcatta
atcctctgcattagatctgtgattagaggacttcagcttcagcaggagtttgtcaatttt
ttcctcctccattataagaaggaagtttctgtttctgatcaaatggaatttgtcaatgga
tggtacattatgattattattagtgacatattgacaatcattggatcaattctaaaaatg
gaaatccaagctaagagtctaactagttatgatgtctgtagcatacttcttgggacttct
accatgctcgtgtggcttggagtcatccgatacctcggtttctttgcaaagtacaacctc
ctcattttgacccttcaggcagcgctgcccaatgtcatcaggttctgctgctgtgcagct
atgatttacttaggttactgcttctgtggatggatcgtgctggggccttaccatgacaag
tttcgttctctgaacatggtctctgagtgccttttctctctgataaatggagatgatatg
tttgccacgtttgcaaaaatgcagcaaaaaagttacttagtctggctgtttagtagaatt
tacctctactcattcatcagcctctttatatatatgattttaagtcttttcattgcactg
atcactgatacatacgaaacaattaagcaataccaacaagatggcttcccagagactgaa
cttcgtacatttatatcagaatgcaaagatctacccaactctggaaaatacagattagaa
gatgaccctccagtatctttattctgctgttgtaaaaagtag

DBGET integrated database retrieval system