KEGG   Homo sapiens (human): 55283Help
Entry
55283             CDS       T01001                                 

Gene name
MCOLN3, TRP-ML3, TRPML3
Definition
(RefSeq) mucolipin 3
  KO
K04994  
mucolipin 3
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPML (Mucolipin)
   55283 (MCOLN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8TDD5(Tbio)
UniProt: 
Position
1p22.3
AA seq 553 aa AA seqDB search
MADPEVVVSSCSSHEEENRCNFNQQTSPSEELLLEDQMRRKLKFFFMNPCEKFWARGRKP
WKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMDDTYAVYTQS
DVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPE
IETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYD
FTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSL
ILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDILTIIGSILKM
EIQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAA
MIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSRI
YLYSFISLFIYMILSLFIALITDTYETIKQYQQDGFPETELRTFISECKDLPNSGKYRLE
DDPPVSLFCCCKK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcctgaggtagttgtgagtagctgcagctctcatgaagaggaaaatcgctgc
aattttaaccagcaaacatctccatctgaggagcttctattagaagaccagatgaggcga
aaactcaaattttttttcatgaatccctgtgagaagttctgggctcgaggtagaaaacca
tggaaacttgccatacaaattctaaaaattgcaatggtgactatccagctggtcttattt
gggctaagtaaccagatggtggtagctttcaaggaagagaatactatagcattcaaacac
cttttcctaaaaggatatatggaccgaatggatgacacatatgcagtgtacacacaaagt
gacgtgtatgatcagttaatcttcgcagtaaaccagtacttgcagctatacaatgtctcc
gttgggaatcatgcttatgagaacaaaggtaccaagcaatctgctatggcaatctgtcag
cacttctacaagcgaggaaacatctaccctggaaatgatacctttgacatcgatccagaa
attgaaactgagtgtttctttgtggagccagatgaaccttttcacattgggacaccagca
gaaaataaactgaacttaacactggacttccacagactcctaacagtggagcttcagttt
aaactgaaagccattaatctgcagacagttcgtcatcaagaactccctgactgttatgac
tttactctgactataacatttgacaacaaggcccatagtggaagaattaaaataagttta
gataatgacatttccatcagagaatgtaaagactggcatgtatctggatcaattcagaag
aacactcattacatgatgatctttgatgcctttgtcattctgacttgcttggtttcatta
atcctctgcattagatctgtgattagaggacttcagcttcagcaggagtttgtcaatttt
ttcctcctccattataagaaggaagtttctgtttctgatcaaatggaatttgtcaatgga
tggtacattatgattattattagtgacatattgacaatcattggatcaattctaaaaatg
gaaatccaagctaagagtctaactagttatgatgtctgtagcatacttcttgggacttct
accatgctcgtgtggcttggagtcatccgatacctcggtttctttgcaaagtacaacctc
ctcattttgacccttcaggcagcgctgcccaatgtcatcaggttctgctgctgtgcagct
atgatttacttaggttactgcttctgtggatggatcgtgctggggccttaccatgacaag
tttcgttctctgaacatggtctctgagtgccttttctctctgataaatggagatgatatg
tttgccacgtttgcaaaaatgcagcaaaaaagttacttagtctggctgtttagtagaatt
tacctctactcattcatcagcctctttatatatatgattttaagtcttttcattgcactg
atcactgatacatacgaaacaattaagcaataccaacaagatggcttcccagagactgaa
cttcgtacatttatatcagaatgcaaagatctacccaactctggaaaatacagattagaa
gatgaccctccagtatctttattctgctgttgtaaaaagtag

DBGET integrated database retrieval system