KEGG   Homo sapiens (human): 55294Help
Entry
55294             CDS       T01001                                 

Gene name
FBXW7, AGO, CDC4, FBW6, FBW7, FBX30, FBXO30, FBXW6, SEL-10, SEL10, hAgo, hCdc4
Definition
(RefSeq) F-box and WD repeat domain containing 7
  KO
K10260  F-box and WD-40 domain protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Module
hsa_M00387  SCF-FBW7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55294 (FBXW7)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    55294 (FBXW7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     55294 (FBXW7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Nup160 ANAPC4_WD40 F-box-like F-box PQQ_2 Ge1_WD40 WD40_like CDtoxinA eIF2A PALB2_WD40 Mem_trans Nop14
Motif
Other DBs
NCBI-GeneID: 55294
NCBI-ProteinID: NP_361014
OMIM: 606278
HGNC: 16712
Ensembl: ENSG00000109670
Vega: OTTHUMG00000185246
Pharos: Q969H0(Tbio)
UniProt: Q969H0
Structure
PDB: 

Jmol
Position
4q31.3
AA seq 707 aa AA seqDB search
MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVV
GVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQ
ESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRS
FSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKM
FQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKD
LLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHR
IDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRD
ATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGH
TNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNAD
STVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL
VTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggaactgctctctgtgggcagcaaaagacgacgaactggaggctctctgaga
ggtaacccttcctcaagccaggtagatgaagaacagatgaatcgtgtggtagaggaggaa
cagcaacagcaactcagacaacaagaggaggagcacactgcaaggaatggtgaagttgtt
ggagtagaacctagacctggaggccaaaatgattcccagcaaggacagttggaagaaaac
aataatagatttatttcggtagatgaggactcctcaggaaaccaagaagaacaagaggaa
gatgaagaacatgctggtgaacaagatgaggaggatgaggaggaggaggagatggaccag
gagagtgacgattttgatcagtctgatgatagtagcagagaagatgaacatacacatact
aacagtgtcacgaactccagtagtattgtggacctgcccgttcaccaactctcctcccca
ttctatacaaaaacaacaaaaatgaaaagaaagttggaccatggttctgaggtccgctct
ttttctttgggaaagaaaccatgcaaagtctcagaatatacaagtaccactgggcttgta
ccatgttcagcaacaccaacaacttttggggacctcagagcagccaatggccaagggcaa
caacgacgccgaattacatctgtccagccacctacaggcctccaggaatggctaaaaatg
tttcagagctggagtggaccagagaaattgcttgctttagatgaactcattgatagttgt
gaaccaacacaagtaaaacatatgatgcaagtgatagaaccccagtttcaacgagacttc
atttcattgctccctaaagagttggcactctatgtgctttcattcctggaacccaaagac
ctgctacaagcagctcagacatgtcgctactggagaattttggctgaagacaaccttctc
tggagagagaaatgcaaagaagaggggattgatgaaccattgcacatcaagagaagaaaa
gtaataaaaccaggtttcatacacagtccatggaaaagtgcatacatcagacagcacaga
attgatactaactggaggcgaggagaactcaaatctcctaaggtgctgaaaggacatgat
gatcatgtgatcacatgcttacagttttgtggtaaccgaatagttagtggttctgatgac
aacactttaaaagtttggtcagcagtcacaggcaaatgtctgagaacattagtgggacat
acaggtggagtatggtcatcacaaatgagagacaacatcatcattagtggatctacagat
cggacactcaaagtgtggaatgcagagactggagaatgtatacacaccttatatgggcat
acttccactgtgcgttgtatgcatcttcatgaaaaaagagttgttagcggttctcgagat
gccactcttagggtttgggatattgagacaggccagtgtttacatgttttgatgggtcat
gttgcagcagtccgctgtgttcaatatgatggcaggagggttgttagtggagcatatgat
tttatggtaaaggtgtgggatccagagactgaaacctgtctacacacgttgcaggggcat
actaatagagtctattcattacagtttgatggtatccatgtggtgagtggatctcttgat
acatcaatccgtgtttgggatgtggagacagggaattgcattcacacgttaacagggcac
cagtcgttaacaagtggaatggaactcaaagacaatattcttgtctctgggaatgcagat
tctacagttaaaatctgggatatcaaaacaggacagtgtttacaaacattgcaaggtccc
aacaagcatcagagtgctgtgacctgtttacagttcaacaagaactttgtaattaccagc
tcagatgatggaactgtaaaactatgggacttgaaaacgggtgaatttattcgaaaccta
gtcacattggagagtggggggagtgggggagttgtgtggcggatcagagcctcaaacaca
aagctggtgtgtgcagttgggagtcggaatgggactgaagaaaccaagctgctggtgctg
gactttgatgtggacatgaagtga

DBGET integrated database retrieval system