KEGG   Homo sapiens (human): 55294Help
Entry
55294             CDS       T01001                                 

Gene name
FBXW7, AGO, CDC4, FBW6, FBW7, FBX30, FBXO30, FBXW6, SEL-10, SEL10, hAgo, hCdc4
Definition
F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase
Orthology
K10260  
F-box and WD-40 domain protein 7
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Module
SCF-FBW7 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31.3
AA seq 589 aa AA seqDB search
MSKPGKPTLNHGLVPVDLKSAKEPLPHQTVMKIFSISIIAQGLPFCRRRMKRKLDHGSEV
RSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWL
KMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEP
KDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQ
HRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLV
GHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGS
RDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQ
GHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGN
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR
NLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaccgggaaaacctactctaaaccatggcttggttcctgttgatcttaaaagt
gcaaaagagcctctaccacatcaaactgtgatgaagatatttagcattagcatcattgcc
caaggcctccctttttgtcgaagacggatgaaaagaaagttggaccatggttctgaggtc
cgctctttttctttgggaaagaaaccatgcaaagtctcagaatatacaagtaccactggg
cttgtaccatgttcagcaacaccaacaacttttggggacctcagagcagccaatggccaa
gggcaacaacgacgccgaattacatctgtccagccacctacaggcctccaggaatggcta
aaaatgtttcagagctggagtggaccagagaaattgcttgctttagatgaactcattgat
agttgtgaaccaacacaagtaaaacatatgatgcaagtgatagaaccccagtttcaacga
gacttcatttcattgctccctaaagagttggcactctatgtgctttcattcctggaaccc
aaagacctgctacaagcagctcagacatgtcgctactggagaattttggctgaagacaac
cttctctggagagagaaatgcaaagaagaggggattgatgaaccattgcacatcaagaga
agaaaagtaataaaaccaggtttcatacacagtccatggaaaagtgcatacatcagacag
cacagaattgatactaactggaggcgaggagaactcaaatctcctaaggtgctgaaagga
catgatgatcatgtgatcacatgcttacagttttgtggtaaccgaatagttagtggttct
gatgacaacactttaaaagtttggtcagcagtcacaggcaaatgtctgagaacattagtg
ggacatacaggtggagtatggtcatcacaaatgagagacaacatcatcattagtggatct
acagatcggacactcaaagtgtggaatgcagagactggagaatgtatacacaccttatat
gggcatacttccactgtgcgttgtatgcatcttcatgaaaaaagagttgttagcggttct
cgagatgccactcttagggtttgggatattgagacaggccagtgtttacatgttttgatg
ggtcatgttgcagcagtccgctgtgttcaatatgatggcaggagggttgttagtggagca
tatgattttatggtaaaggtgtgggatccagagactgaaacctgtctacacacgttgcag
gggcatactaatagagtctattcattacagtttgatggtatccatgtggtgagtggatct
cttgatacatcaatccgtgtttgggatgtggagacagggaattgcattcacacgttaaca
gggcaccagtcgttaacaagtggaatggaactcaaagacaatattcttgtctctgggaat
gcagattctacagttaaaatctgggatatcaaaacaggacagtgtttacaaacattgcaa
ggtcccaacaagcatcagagtgctgtgacctgtttacagttcaacaagaactttgtaatt
accagctcagatgatggaactgtaaaactatgggacttgaaaacgggtgaatttattcga
aacctagtcacattggagagtggggggagtgggggagttgtgtggcggatcagagcctca
aacacaaagctggtgtgtgcagttgggagtcggaatgggactgaagaaaccaagctgctg
gtgctggactttgatgtggacatgaagtga

DBGET integrated database retrieval system