KEGG   Homo sapiens (human): 5530Help
Entry
5530              CDS       T01001                                 

Gene name
PPP3CA, CALN, CALNA, CALNA1, CCN1, CNA1, PPP2B
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Drug target
Ciclosporin: 
Pimecrolimus: 
Tacrolimus (DG00439): 
Voclosporin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5530 (PPP3CA)
   04310 Wnt signaling pathway
    5530 (PPP3CA)
   04370 VEGF signaling pathway
    5530 (PPP3CA)
   04020 Calcium signaling pathway
    5530 (PPP3CA)
   04022 cGMP - PKG signaling pathway
    5530 (PPP3CA)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5530 (PPP3CA)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5530 (PPP3CA)
   04660 T cell receptor signaling pathway
    5530 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    5530 (PPP3CA)
   04659 Th17 cell differentiation
    5530 (PPP3CA)
   04662 B cell receptor signaling pathway
    5530 (PPP3CA)
  Endocrine system
   04922 Glucagon signaling pathway
    5530 (PPP3CA)
   04921 Oxytocin signaling pathway
    5530 (PPP3CA)
   04924 Renin secretion
    5530 (PPP3CA)
  Nervous system
   04724 Glutamatergic synapse
    5530 (PPP3CA)
   04728 Dopaminergic synapse
    5530 (PPP3CA)
   04720 Long-term potentiation
    5530 (PPP3CA)
  Development
   04360 Axon guidance
    5530 (PPP3CA)
   04380 Osteoclast differentiation
    5530 (PPP3CA)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5530 (PPP3CA)
   05014 Amyotrophic lateral sclerosis (ALS)
    5530 (PPP3CA)
  Substance dependence
   05031 Amphetamine addiction
    5530 (PPP3CA)
  Infectious diseases
   05152 Tuberculosis
    5530 (PPP3CA)
   05166 HTLV-I infection
    5530 (PPP3CA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5530 (PPP3CA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5530 (PPP3CA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q08209(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 521 aa AA seqDB search
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcgcatcttatgaaggagggaaggctggaagagagtgtt
gcattgagaataataacagagggtgcatcaattcttcgacaggaaaaaaatttgctggat
attgatgcgccagtcactgtttgtggggacattcatggacaattctttgatttgatgaag
ctctttgaagtcgggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtattgaatgtgtgctgtatttgtgggccttgaaaattctctac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgatgcctgtatggat
gcctttgactgccttcccctggctgccctgatgaaccaacagttcctgtgtgtgcatggt
ggtttgtctccagagattaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcatatggacctatgtgtgatatcctgtggtcagaccccctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatactccgagcc
cacgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgtttttacttggtcccttccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaactagggtcagaa
gaagatggatttgatggtgcaacagctgcagcccggaaagaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagtgctcagagaagagagtgagagtgtg
ctgacgctgaaaggcttgaccccaactggcatgctccccagcggagtactttctggaggg
aagcaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaagccaagggcttagaccgaattaat
gagaggatgccgcctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcacctcagagactaacggcacggacagcaatggcagtaatagcagcaatatt
cagtga

KEGG   Homo sapiens (human): 5532Help
Entry
5532              CDS       T01001                                 

Gene name
PPP3CB, CALNA2, CALNB, CNA2, PP2Bbeta
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Drug target
Ciclosporin: 
Pimecrolimus: 
Tacrolimus (DG00439): 
Voclosporin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5532 (PPP3CB)
   04310 Wnt signaling pathway
    5532 (PPP3CB)
   04370 VEGF signaling pathway
    5532 (PPP3CB)
   04020 Calcium signaling pathway
    5532 (PPP3CB)
   04022 cGMP - PKG signaling pathway
    5532 (PPP3CB)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5532 (PPP3CB)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5532 (PPP3CB)
   04660 T cell receptor signaling pathway
    5532 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    5532 (PPP3CB)
   04659 Th17 cell differentiation
    5532 (PPP3CB)
   04662 B cell receptor signaling pathway
    5532 (PPP3CB)
  Endocrine system
   04922 Glucagon signaling pathway
    5532 (PPP3CB)
   04921 Oxytocin signaling pathway
    5532 (PPP3CB)
   04924 Renin secretion
    5532 (PPP3CB)
  Nervous system
   04724 Glutamatergic synapse
    5532 (PPP3CB)
   04728 Dopaminergic synapse
    5532 (PPP3CB)
   04720 Long-term potentiation
    5532 (PPP3CB)
  Development
   04360 Axon guidance
    5532 (PPP3CB)
   04380 Osteoclast differentiation
    5532 (PPP3CB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5532 (PPP3CB)
   05014 Amyotrophic lateral sclerosis (ALS)
    5532 (PPP3CB)
  Substance dependence
   05031 Amphetamine addiction
    5532 (PPP3CB)
  Infectious diseases
   05152 Tuberculosis
    5532 (PPP3CB)
   05166 HTLV-I infection
    5532 (PPP3CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5532 (PPP3CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5532 (PPP3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P16298(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.2
AA seq 524 aa AA seqDB search
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtccctttccccccaacacatcgcttgacatct
gaagaagtatttgatttggatgggatacccagggttgatgttctgaagaaccacttggtg
aaagaaggtcgagtagatgaagaaattgcgcttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaagctccaatcacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggcgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggttctgaagattctatacccaagcacattatttcttctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaagtattcg
gaaagagtctatgaagcttgtatggaagcttttgatagtttgcctcttgctgcactttta
aaccaacagtttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgtta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcctaattttatggatgtcttcacg
tggtctttaccgtttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccagtttgatggttcagctgcagcc
cggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagagtcttctct
gttctcagggaggagagtgaaagtgtgctgacactcaagggcctgactcccacagggatg
ttgcctagtggagtgttagctggaggacggcagaccctgcaaagtgccacagttgaggct
attgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagttttgaa
gaggcaaagggtttggataggatcaatgagagaatgccacctcggaaagatgctgtacag
caagatggtttcaattctctgaacaccgcacatgccactgagaaccacgggacgggcaac
catactgcccagtga

KEGG   Homo sapiens (human): 5533Help
Entry
5533              CDS       T01001                                 

Gene name
PPP3CC, CALNA3, CNA3, PP2Bgamma
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  
serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Drug target
Ciclosporin: 
Pimecrolimus: 
Tacrolimus (DG00439): 
Voclosporin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5533 (PPP3CC)
   04310 Wnt signaling pathway
    5533 (PPP3CC)
   04370 VEGF signaling pathway
    5533 (PPP3CC)
   04020 Calcium signaling pathway
    5533 (PPP3CC)
   04022 cGMP - PKG signaling pathway
    5533 (PPP3CC)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5533 (PPP3CC)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5533 (PPP3CC)
   04660 T cell receptor signaling pathway
    5533 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    5533 (PPP3CC)
   04659 Th17 cell differentiation
    5533 (PPP3CC)
   04662 B cell receptor signaling pathway
    5533 (PPP3CC)
  Endocrine system
   04922 Glucagon signaling pathway
    5533 (PPP3CC)
   04921 Oxytocin signaling pathway
    5533 (PPP3CC)
   04924 Renin secretion
    5533 (PPP3CC)
  Nervous system
   04724 Glutamatergic synapse
    5533 (PPP3CC)
   04728 Dopaminergic synapse
    5533 (PPP3CC)
   04720 Long-term potentiation
    5533 (PPP3CC)
  Development
   04360 Axon guidance
    5533 (PPP3CC)
   04380 Osteoclast differentiation
    5533 (PPP3CC)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5533 (PPP3CC)
   05014 Amyotrophic lateral sclerosis (ALS)
    5533 (PPP3CC)
  Substance dependence
   05031 Amphetamine addiction
    5533 (PPP3CC)
  Infectious diseases
   05152 Tuberculosis
    5533 (PPP3CC)
   05166 HTLV-I infection
    5533 (PPP3CC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5533 (PPP3CC)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     5533 (PPP3CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P48454(Tbio)
UniProt: 
Position
8p21.3
AA seq 512 aa AA seqDB search
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaggcgcttccacctctccaccaccgaccgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttcaaggaagtatttgagaatgggaaacctaaagttgat
gttttaaaaaaccatttggtaaaggaaggacgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgaggcaagagaagactatgatagaagtagatgctcca
atcacagtatgtggtgatattcatggacaattctttgacctaatgaagttatttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagattaatcatcccaaaacattg
tttctgcttcggggaaatcatgaatgcaggcatcttacagactatttcaccttcaaacag
gaatgtcgaatcaaatattcggaacaggtgtatgatgcctgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaattacttctttagatgacattaggaaattagacaggtttacggaacctcccgccttt
ggacctgtgtgtgacctgctttggtctgatccctcagaggattatggcaatgagaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttctacagttaccctgca
gtttgtgaatttttgcagaacaataatttactatcaattatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaagccacaggctttccatcacttattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttgaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggtaaatgtgctcaacatatgctctgatgacgaactgatttctgatgatgaagcagaa
ggaagcactacagttcgtaaggagatcatcaggaataagatcagagccattgggaagatg
gcacgggtcttttcaattcttcggcaagaaagtgagagtgtgctgactctcaagggcctg
actcccacaggcacactccctctgggcgtcctctcaggaggcaagcagactatcgagaca
gccacagtagaagcggtagaggcccgggaagccatcagagggttctcgcttcagcacaag
atccggagttttgaagaagcgcgaggtctggaccgaattaatgagcgaatgccaccccga
aaggatagcatacacgctggtgggccaatgaaatctgtaacctcagcacactcacatgct
gcgcacaggagcgaccaagggaagaaagcccattcatga

KEGG   Homo sapiens (human): 5534Help
Entry
5534              CDS       T01001                                 

Gene name
PPP3R1, CALNB1, CNB, CNB1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Drug target
Ciclosporin: 
Pimecrolimus: 
Tacrolimus (DG00439): 
Voclosporin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5534 (PPP3R1)
   04310 Wnt signaling pathway
    5534 (PPP3R1)
   04370 VEGF signaling pathway
    5534 (PPP3R1)
   04020 Calcium signaling pathway
    5534 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    5534 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5534 (PPP3R1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5534 (PPP3R1)
   04660 T cell receptor signaling pathway
    5534 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    5534 (PPP3R1)
   04659 Th17 cell differentiation
    5534 (PPP3R1)
   04662 B cell receptor signaling pathway
    5534 (PPP3R1)
  Endocrine system
   04922 Glucagon signaling pathway
    5534 (PPP3R1)
   04921 Oxytocin signaling pathway
    5534 (PPP3R1)
   04924 Renin secretion
    5534 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    5534 (PPP3R1)
   04720 Long-term potentiation
    5534 (PPP3R1)
  Development
   04360 Axon guidance
    5534 (PPP3R1)
   04380 Osteoclast differentiation
    5534 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5534 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    5534 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    5534 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    5534 (PPP3R1)
   05166 HTLV-I infection
    5534 (PPP3R1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     5534 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P63098(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p14
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct
cagttcagtgtcaaaggagataaggagcagaaattgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Homo sapiens (human): 5535Help
Entry
5535              CDS       T01001                                 

Gene name
PPP3R2, PPP3RL
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Drug target
Ciclosporin: 
Pimecrolimus: 
Tacrolimus (DG00439): 
Voclosporin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5535 (PPP3R2)
   04310 Wnt signaling pathway
    5535 (PPP3R2)
   04370 VEGF signaling pathway
    5535 (PPP3R2)
   04020 Calcium signaling pathway
    5535 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    5535 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5535 (PPP3R2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5535 (PPP3R2)
   04660 T cell receptor signaling pathway
    5535 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    5535 (PPP3R2)
   04659 Th17 cell differentiation
    5535 (PPP3R2)
   04662 B cell receptor signaling pathway
    5535 (PPP3R2)
  Endocrine system
   04922 Glucagon signaling pathway
    5535 (PPP3R2)
   04921 Oxytocin signaling pathway
    5535 (PPP3R2)
   04924 Renin secretion
    5535 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    5535 (PPP3R2)
   04720 Long-term potentiation
    5535 (PPP3R2)
  Development
   04360 Axon guidance
    5535 (PPP3R2)
   04380 Osteoclast differentiation
    5535 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5535 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    5535 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    5535 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    5535 (PPP3R2)
   05166 HTLV-I infection
    5535 (PPP3R2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     5535 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q96LZ3(Tbio)
UniProt: 
Position
9q31.1
AA seq 173 aa AA seqDB search
MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga
gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg
gggacctcccagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgttcagc
atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatc
atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtatga

DBGET integrated database retrieval system