KEGG   Homo sapiens (human): 55300Help
Entry
55300             CDS       T01001                                 

Gene name
PI4K2B, PI4KIIB, PIK42B
Definition
(RefSeq) phosphatidylinositol 4-kinase type 2 beta
  KO
K13711  
phosphatidylinositol 4-kinase type 2 [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    55300 (PI4K2B)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    55300 (PI4K2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     55300 (PI4K2B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    55300 (PI4K2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8TCG2(Tbio)
UniProt: 
Position
4p15.2
AA seq 481 aa AA seqDB search
MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAG
DEELPLPPGDVGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVG
IFPERISQGSSGSYFVKDPKRKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCL
IPNQGYLSEAGAYLVDNKLHLSIVPKTKVVWLVSETFNYNAIDRAKSRGKKYALEKVPKV
GRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPENIRKQFQSQFERLVILDYII
RNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFPFKHPDEWRAY
PFHWAWLPQAKVPFSEEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSV
MRGQILNLTQALRDGKSPFQLVQIPCVIVERSQGGSQGRIVHLSNSFTQTVNCRKPFFSS
W
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggaggatccctccgagcccgaccggttggcgtccgcggacggcgggagcccggaggag
gaggaggatggggagcgggagccgctgctaccgcggatcgcctgggcccacccgcggaga
ggcgccccaggcagcgccgtgaggctgctggacgctgccggggaggagggcgaggccggc
gacgaggagctgcccctcccgcccggggacgtgggggtctcccggagttcgtccgccgag
ctggaccggagccgccccgcggtttcagtaactattggtacttcagagatgaatgcattc
ttggatgacccagaatttgccgatattatgctgagagcagagcaagcaatagaagttgga
atttttccagaaagaatctctcaaggttcaagtggaagttactttgtgaaggatcctaag
aggaaaattattggtgtgtttaaacccaaatcagaagagccttatggtcaactcaatcca
aaatggaccaaatatgtccataaggtctgctgcccttgctgctttggccgaggctgcctg
attcctaatcaggggtacctttccgaagcgggtgcctatcttgtggacaacaagcttcat
ctgagcattgtacctaaaacaaaggtggtttggcttgtcagtgagacatttaactataat
gcgattgaccgtgcaaaatcaagaggcaaaaagtatgctttagaaaaagtgccaaaagtg
ggtagaaagtttcataggataggactccctcctaagattggttcctttcagttatttgtt
gaaggttacaaggaggctgaatattggcttaggaaatttgaagctgaccctttgcctgag
aatattagaaaacaatttcagtcacaatttgaaagattagttattttggattacatcatc
agaaatacagacaggggcaatgataattggttagtcagatacgaaaagcagaaatgtgaa
aaggaaattgaccataaggaatcaaaatggattgatgatgaagaattccttattaaaata
gctgcaattgataatggtctagcatttccttttaaacatcctgatgaatggagagcatat
ccatttcactgggcttggcttcctcaagcaaaagttcccttttctgaagaaataagaaat
ttgattctaccatatatttctgacatgaactttgtgcaagatttatgtgaagatctctat
gaactttttaagactgacaaaggatttgacaaagccacttttgaaagtcagatgtctgtg
atgaggggtcagatcttaaaccttactcaggcattgagagacgggaagagtcctttccag
ctagtacagataccttgtgtgattgtggaacgcagtcaaggtggaagtcagggtcggatt
gtccacctgagcaattcctttacccagactgtcaattgcaggaagccatttttttcctcc
tggtag

DBGET integrated database retrieval system