KEGG   Homo sapiens (human): 55304Help
Entry
55304             CDS       T01001                                 

Gene name
SPTLC3, C20orf38, LCB2B, LCB3, SPT3, SPTLC2L, dJ718P11, dJ718P11.1, hLCB2b
Definition
(RefSeq) serine palmitoyltransferase long chain base subunit 3
  KO
K00654  
serine palmitoyltransferase [EC:2.3.1.50]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Sphingolipid signaling pathway
Module
Ceramide biosynthesis
Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    55304 (SPTLC3)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    55304 (SPTLC3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     55304 (SPTLC3)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class II
   55304 (SPTLC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NUV7(Tbio)
UniProt: 
Position
20p12.1
AA seq 552 aa AA seqDB search
MANPGGGAVCNGKLHNHKKQSNGSQSRNCTKNGIVKEAQQNGKPHFYDKLIVESFEEAPL
HVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYM
RIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDES
MRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPA
LVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWK
KILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRGVTEFFGLDPH
EVDVLMGTFTKSFGASGGYIAGRKDLVDYLRVHSHSAVYASSMSPPIAEQIIRSLKLIMG
LDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVPLLLYMPGKVAAFARHMLE
KKIGVVVVGFPATPLAEARARFCVSAAHTREMLDTVLEALDEMGDLLQLKYSRHKKSARP
ELYDETSFELED
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctaaccctggaggtggtgctgtttgcaacgggaaacttcacaatcacaagaaacag
agcaatggctcacaaagcagaaactgcacaaagaatggaatagtgaaggaagcccagcaa
aatgggaagccacatttttatgataagctcattgttgaatcgtttgaggaagcacccctt
catgttatggttttcacttacatgggatatggaattggaaccctgtttggctatctcaga
gactttttaagaaactggggaatagaaaaatgcaacgcagctgtggaacgaaaagaacaa
aaagattttgtgccactgtatcaagactttgaaaatttttatacaagaaacctttacatg
cgaatcagagacaactggaaccggcccatctgcagtgccccagggcctctgtttgatttg
atggagagggtatcagacgactataactggacgtttaggtttactggaagagtcatcaaa
gatgtcatcaacatgggctcctataacttccttggtcttgcagccaagtatgatgagtct
atgaggacaataaaggatgttttagaggtgtatggcacaggcgtggccagcaccaggcat
gaaatgggcaccttggataagcacaaggagttggaggaccttgtggctaagttcctgaat
gtggaagcagctatggtctttgggatgggattcgcaactaactcaatgaatatcccagca
ttagttggaaagggatgcctcattttaagtgatgagttaaaccacacatcgcttgtgctt
ggggcccgactctcaggtgcaaccataagaatcttcaaacacaacaacacacaaagccta
gagaagctcctgagagatgctgtcatctatggccagcctcgaacccgcagagcttggaaa
aagattctcatcctggtggagggtgtctacagcatggaaggttccatcgtgcatctgccc
cagatcatagctctaaagaagaaatacaaggcttacctctacatagatgaagctcacagt
attggggccgtgggcccaaccggccggggtgtcacggagttctttggactagaccctcat
gaagttgatgtgctcatgggcacattcaccaaaagttttggagcttcaggaggttacata
gctggaaggaaggacctcgtggattatttacgggttcactcgcatagtgctgtttatgct
tcatccatgagcccaccgatagcagagcaaatcatcagatcactaaaacttatcatggga
ctggatgggaccactcaagggctgcagagagtacagcaacttgcgaaaaacacaagatac
ttcagacaaagactgcaggaaatgggattcattatctatggcaatgagaatgcttctgtt
gttcctctgcttctttatatgcctggtaaagtagcggcttttgcaaggcatatgctagag
aaaaaaattggagtggtggtcgtgggatttccagccactcccctcgcagaagctcgggct
cggttttgtgtttcagcggcacatacccgggagatgttagacacggttttagaagctctt
gatgaaatgggtgatctcttgcaactgaaatattcccggcacaagaagtcagcacgtcct
gagctctatgatgagacgagctttgaactcgaagattaa

DBGET integrated database retrieval system