KEGG   Homo sapiens (human): 55324Help
Entry
55324             CDS       T01001                                 

Gene name
ABCF3, EST201864
Definition
(RefSeq) ATP binding cassette subfamily F member 3
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
hsa  Homo sapiens (human)
Brite
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   Initiation associated factors
    55324 (ABCF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC_tran_Xtn AAA_21 SMC_N AAA_22 AAA_16 MMR_HSR1 AAA_29 NACHT RsgA_GTPase AAA_24 AAA AAA_15 AAA_28 DUF1672 Dynamin_N DUF87 AAA_23
Motif
Other DBs
NCBI-GeneID: 55324
NCBI-ProteinID: NP_060828
HGNC: 72
Ensembl: ENSG00000161204
Vega: OTTHUMG00000156824
Pharos: Q9NUQ8(Tdark)
UniProt: Q9NUQ8 A0A0S2Z5L1
Position
3q27.1
AA seq 709 aa AA seqDB search
MATCAEILRSEFPEIDGQVFDYVTGVLHSGSADFESVDDLVEAVGELLQEVSGDSKDDAG
IRAVCQRMYNTLRLAEPQSQGNSQVLLDAPIQLSKITENYDCGTKLPGLLKREQSSTVNA
KKLEKAEARLKAKQEKRSEKDTLKTSNPLVLEEASASQAGSRKESRLESSGKNKSYDVRI
ENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHISLLHVE
QEVAGDDTPALQSVLESDSVREDLLRRERELTAQIAAGRAEGSEAAELAEIYAKLEEIEA
DKAPARASVILAGLGFTPKMQQQPTREFSGGWRMRLALARALFARPDLLLLDEPTNMLDV
RAILWLENYLQTWPSTILVVSHDRNFLNAIATDIIHLHSQRLDGYRGDFETFIKSKQERL
LNQQREYEAQQQYRQHIQVFIDRFRYNANRASQVQSKLKMLEKLPELKPVDKESEVVMKF
PDGFEKFSPPILQLDEVDFYYDPKHVIFSRLSVSADLESRICVVGENGAGKSTMLKLLLG
DLAPVRGIRHAHRNLKIGYFSQHHVEQLDLNVSAVELLARKFPGRPEEEYRHQLGRYGIS
GELAMRPLASLSGGQKSRVAFAQMTMPCPNFYILDEPTNHLDMETIEALGRALNNFRGGV
ILVSHDERFIRLVCRELWVCEGGGVTRVEGGFDQYRALLQEQFRREGFL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttgcgccgaaatcctgcggagcgagttccccgaaattgacggacaagtcttc
gactacgtgaccggcgtcttgcacagcggcagcgcggacttcgagtctgtggatgacctg
gtggaagctgtaggggaactattgcaagaggtgtccggggacagcaaggatgacgcgggc
atcagggccgtgtgccagcgcatgtacaacactctgcgtctggctgagccacaaagccag
ggaaatagccaggtgctactggacgcccctatccagttgtcaaagataacggagaactac
gactgtggaaccaaacttccaggactgctaaagagggaacagtcctcgacagtgaatgca
aagaagttagagaaggccgaggctcgacttaaggcaaagcaggagaagcgctcagagaag
gacacgctcaagaccagcaaccctctagtcttagaagaggcatcagccagccaggcaggc
agcagaaaggagagtcggttggaatcatctggcaagaacaaatcctatgatgtgcgaatt
gagaactttgatgtgtcttttggcgatagagtactgctggctggagcggatgtgaacctg
gcatggggccgccgttacgggctggtggggcggaatgggttggggaagacaacgttactg
aagatgctggccacccggagtctgcgggttccagcccacatttccctgctgcacgttgag
caagaggttgctggagatgacactcctgccctgcagagtgtgctggagagtgacagtgtg
cgagaggatttgctacggagggagcgggagctcactgcccagattgctgctggcagggcg
gagggctctgaagctgcagagctggcagaaatctatgccaaactggaggagattgaggct
gacaaggcacctgccagggcatcagtcattctcgctgggcttggctttacccctaaaatg
cagcagcagcccacccgggagttctcaggtggctggaggatgaggctggccctggcccgg
gccctctttgctaggccagatcttctgctgttagatgaacctacaaacatgctggatgtc
agggccatcctgtggctggagaattacctgcagacgtggccctccaccatcctagtcgtc
tcccacgaccgcaacttcttgaatgccatcgccacagacatcatccacctgcacagccag
cggctagatggttaccggggagactttgagaccttcatcaagagtaagcaggagcggctg
ctcaaccagcagcgtgaatatgaggcgcagcagcagtatcgccagcacatccaggttttc
attgaccggtttcgctacaatgccaacagggcctctcaagtgcagagtaaactcaagatg
ctggagaagctgcctgagctgaagcctgtggacaaggaatcagaggtcgtaatgaagttc
cctgatgggtttgagaagttctcgccgccaattctgcagctagatgaggtggatttctac
tacgatccgaagcacgtcatcttcagtcgcctctctgtgtctgctgatctcgagtctcgc
atctgtgtggttggagagaatggggctgggaagtctaccatgctgaagctgcttttgggg
gacctggcacctgttcggggcatcagacacgctcacaggaatctgaagattggctatttc
agccagcaccatgtggagcagctggacctaaacgtcagtgctgtggaactgctggcacgc
aagtttcctgggcggcctgaggaggagtaccgtcaccagctgggtcggtatggcatctcc
ggagaactggccatgcgtcctcttgccagcctgtctgggggccagaagagccgagtggcc
tttgctcagatgactatgccctgccccaacttctacattctggatgaacccacaaaccac
ctggacatggagaccattgaggctctgggccgtgccctcaacaatttcaggggtggtgtg
attctggtgtcccacgatgagcgctttatcaggctggtgtgccgggagttgtgggtatgc
gaaggaggcggcgtcacccgtgtggaaggaggatttgaccagtaccgcgccctcctccag
gaacagttccgccgcgaaggcttcctctag

DBGET integrated database retrieval system