KEGG   Homo sapiens (human): 55341Help
Entry
55341             CDS       T01001                                 

Gene name
LSG1
Definition
(RefSeq) large 60S subunit nuclear export GTPase 1
  KO
K14539  
large subunit GTPase 1 [EC:3.6.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55341 (LSG1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     55341 (LSG1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   GTPases
    55341 (LSG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H089(Tbio)
UniProt: 
Position
3q29
AA seq 658 aa AA seqDB search
MGRRRAPAGGSLGRALMRHQTQRSRSHRHTDSWLHTSELNDGYDWGRLNLQSVTEQSSLD
DFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWN
QNTTPEELKQAEKDNFLEWRRQLVRLEEEQKLILTPFERNLDFWRQLWRVIERSDIVVQI
VDARNPLLFRCEDLECYVKEMDANKENVILINKADLLTAEQRSAWAMYFEKEDVKVIFWS
ALAGAIPLNGDSEEEANRDDRQSNTTKFGHSSFDQAEISHSESEHLPARDSPSLSENPTT
DEDDSEYEDCPEEEEDDWQTCSEEDGPKEEDCSQDWKESSTADSEARSRKTPQKRQIHNF
SHLVSKQELLELFKELHTGRKVKDGQLTVGLVGYPNVGKSSTINTIMGNKKVSVSATPGH
TKHFQTLYVEPGLCLCDCPGLVMPSFVSTKAEMTCSGILPIDQMRDHVPPVSLVCQNIPR
HVLEATYGINIITPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILKDYV
SGKLLYCHPPPGRDPVTFQHQHQRLLENKMNSDEIKMQLGRNKKAKQIENIVDKTFFHQE
NVRALTKGVQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEKSRRLYKHLDM
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaggagagccccggccggtgggtcgctgggacgggcccttatgcgccatcag
actcagcggagccgaagccatcgtcacactgactcctggttgcacacaagtgaactcaat
gatggctatgattggggtcgtcttaatcttcagtcagtgactgaacagagctcccttgat
gacttccttgctactgcagaacttgcaggaacagagtttgtagctgagaaacttaatatt
aagtttgtgcctgctgaggctagaactggactactgtctttcgaggagagccagagaatt
aagaagctccatgaagaaaacaaacagttcttgtgtataccgaggagaccaaactggaac
caaaatactaccccagaagaactcaaacaagcagagaaagataactttctagaatggaga
cgtcagcttgtccggctagaagaggaacagaagctgatattgactccatttgaacgaaat
ttggacttttggcgccagctctggagagtcattgagagaagtgatattgtggtccagata
gtagatgctcgaaacccactcctgtttagatgtgaggatttggaatgttatgtgaaagaa
atggatgccaataaggagaacgtcattctgatcaacaaggcagacttgctgactgctgag
cagcggagtgcctgggccatgtacttcgaaaaagaagatgtgaaggttattttctggtca
gctttggccggagccattcccctgaatggtgactctgaggaagaggcaaacagagatgat
agacaaagcaacacaaccaagtttggacattccagtttcgaccaggctgaaatttcccac
agtgaatccgaacatctcccagctagggattctccttcacttagtgaaaatcccacaacg
gatgaagatgacagtgagtatgaggactgtccagaggaggaggaagacgactggcagacg
tgctcagaagaagacggtcccaaggaagaggactgcagccaggactggaaggaaagctct
actgcagattctgaggctcggagcaggaaaaccccacagaagaggcagatacacaatttt
agccatctggtatccaagcaggagttactggagctctttaaggagctacacactgggaga
aaggtgaaagatgggcaacttacggtcggactggtgggctaccctaatgttggtaagagt
tcaacaatcaacaccatcatgggcaacaagaaagtatctgtgtctgccacacctggtcac
acaaagcactttcagactctctatgtggagcctggcctctgcctgtgtgactgtcctggc
ttggtgatgccatcttttgtgtctaccaaggcagaaatgacttgcagcggaatcctccca
attgatcagatgagagatcatgttcctcctgtatcactagtttgccagaatattccaaga
catgttttagaagctacctatggcattaacatcataacgcctagagaggatgaagatccc
caccgacctccaacatcggaagaactgttgacagcttatggatacatgcgaggattcatg
acagcgcatggacagccagaccagcctcgatctgcgcgctacatcctgaaggactatgtc
agtggtaagctgctgtactgccatcctcctcctggaagagatcctgtaacttttcagcat
caacaccagcgactcctagagaacaaaatgaacagtgatgaaataaaaatgcagctaggc
agaaataaaaaagcaaagcagattgaaaatatcgttgacaaaacttttttccatcaagag
aatgtgagggctttgaccaaaggagtccaggctgtgatgggttacaagcccgggagtggt
gtagtgactgcatccactgcgagctctgagaacggggcggggaagccctggaaaaaacat
ggcaacagaaataaaaaagaaaaaagtcgtagactctacaagcacctggatatgtga

DBGET integrated database retrieval system