KEGG   Homo sapiens (human): 5536Help
Entry
5536              CDS       T01001                                 

Gene name
PPP5C, PP5, PPP5, PPT
Definition
protein phosphatase 5, catalytic subunit (EC:3.1.3.16)
Orthology
K04460  
serine/threonine-protein phosphatase 5 [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5536 (PPP5C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5536 (PPP5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    Catalytic subunits
     5536 (PPP5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 477 aa AA seqDB search
MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS
NAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPK
LEDGKVTISFMKELMQWYKDQKKLHRKCAYQTEKITVCGDTHGQFYDLLNIFELNGLPSE
TNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAK
YTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMC
DLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRC
VTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggcggagggcgagaggactgagtgtgctgagcccccccgggacgaacccccg
gctgatggagctctgaagcgggcagaggagctcaagactcaggccaatgactacttcaaa
gccaaggactacgagaacgccatcaagttctacagccaggccatcgagctgaaccccagc
aatgccatctactatggcaaccgcagcctggcctacctgcgcactgagtgctatggctac
gcgctgggagacgccacgcgggccattgagctggacaagaagtacatcaagggttattac
cgccgggctgccagcaacatggcactgggcaagttccgggccgcgctgcgagactacgag
acggtggtcaaggtgaagccccatgacaaggatgccaaaatgaaataccaggagtgcaac
aagatcgtgaagcagaaggcctttgagcgggccatcgcgggcgacgagcacaagcgctcc
gtggtggactcgctggacatcgagagcatgaccattgaggatgagtacagcggacccaag
cttgaagacggcaaagtgacaatcagtttcatgaaggagctcatgcagtggtacaaggac
cagaagaaactgcaccggaaatgtgcctaccagacagagaagattacagtatgtggggac
acccatggccagttctatgacctcctcaacatattcgagctcaacggtttaccctcggag
accaacccctatatatttaatggtgactttgtggaccgaggctccttctctgtagaagtg
atcctcacccttttcggcttcaagctcctgtacccagatcactttcacctccttcgaggc
aaccacgagacagacaacatgaaccagatctacggtttcgagggtgaggtgaaggccaag
tacacagcccagatgtacgagctctttagcgaggtgttcgagtggctcccgttggcccag
tgcatcaacggcaaagtgctgatcatgcacggaggcctgttcagtgaagacggtgtcacc
ctggatgacatccggaaaattgagcggaatcgacaacccccagattcagggcccatgtgt
gacctgctctggtcagatccacagccacagaacgggcgctcgatcagcaagcggggcgtg
agctgtcagtttgggcctgacgtcaccaaggccttcttggaagagaacaacctggactat
atcatccgcagccacgaagtcaaggccgagggctacgaggtggctcacggaggccgctgt
gtcaccgtcttctctgcccccaactactgcgaccagatggggaacaaagcctcctacatc
cacctccagggctctgacctacggcctcagttccaccagttcacagcagtgcctcatccc
aacgtcaagcccatggcctatgccaacacgctgctgcagctaggaatgatgtga

DBGET integrated database retrieval system