KEGG   Homo sapiens (human): 55366Help
Entry
55366             CDS       T01001                                 

Gene name
LGR4, BNMD17, GPR48
Definition
(RefSeq) leucine rich repeat containing G protein-coupled receptor 4
  KO
K04309  leucine-rich repeat-containing G protein-coupled receptor 4
Organism
hsa  Homo sapiens (human)
Disease
H01593  Osteoporosis
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   LGR like
    55366 (LGR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRR_1 7tm_1 LRRNT LRR_6
Motif
Other DBs
NCBI-GeneID: 55366
NCBI-ProteinID: NP_060960
OMIM: 606666
HGNC: 13299
Ensembl: ENSG00000205213
Vega: OTTHUMG00000133508
Pharos: Q9BXB1(Tbio)
UniProt: Q9BXB1 Q59ER8
Structure
PDB: 

Jmol
Position
11p14.1
AA seq 951 aa AA seqDB search
MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLK
QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcccgctagggctgctctgcttcctcgccctggggctgctcggctcggccggg
cccagcggcgcggcgccgcctctctgcgcggcgccctgcagctgcgacggcgaccgtcgg
gtggactgctccgggaaggggctgacggccgtgcccgaggggctcagcgccttcacccaa
gcgctggatatcagtatgaacaacattactcagttgccagaagatgcatttaagaacttt
ccttttctagaagagctacaattggcgggcaacgacctttcttttatccacccaaaggcc
ttgtctgggttgaaagaactcaaagttctaacgctccagaataatcagttgaaaacagta
cccagtgaagccattcgagggctgagtgctttgcagtctttgcgtttagatgccaaccat
attacctcagtccccgaggacagttttgaaggacttgttcagttacggcatctgtggctg
gatgacaacagcttgacggaggtgcctgtgcaccccctcagcaatctgcccaccctacag
gcgctgaccctggctctcaacaagatctcaagcatccctgactttgcatttaccaacctt
tcaagcctggtagttctgcatcttcataacaataaaattagaagcctgagtcaacactgt
tttgatggactagataacctggagaccttagacttgaattataataacttgggggaattt
cctcaggctattaaagcccttcctagccttaaagagctaggatttcatagtaattctatt
tctgttatccctgatggagcatttgatggtaatccactcttaagaactatacatttgtat
gataatcctctgtcttttgtggggaactcagcatttcacaatttatctgatcttcattcc
ctagtcattcgtggtgcaagcatggtgcagcagttccccaatcttacaggaactgtccac
ctggaaagtctgactttgacaggtacaaagataagcagcatacctaataatttgtgtcaa
gaacaaaagatgcttaggactttggacttgtcttacaataatataagagaccttccaagt
tttaatggttgccatgctctggaagaaatttctttacagcgtaatcaaatctaccaaata
aaggaaggcacctttcaaggcctgatatctctaaggattctagatctgagtagaaacctg
atacatgaaattcacagtagagcttttgccacacttgggccaataactaacctagatgta
agtttcaatgaattaacttcctttcctacggaaggcctgaatgggctaaatcaactgaaa
cttgtgggcaacttcaagctgaaagaagccttagcagcaaaagactttgttaacctcagg
tctttatcagtaccatatgcttatcagtgctgtgcattttggggttgtgactcttatgca
aatttaaacacagaagataacagcctccaggaccacagtgtggcacaggagaaaggtact
gctgatgcagcaaatgtcacaagcactcttgaaaatgaagaacatagtcaaataattatc
cattgtacaccttcaacaggtgcttttaagccctgtgaatatttactgggaagctggatg
attcgtcttactgtgtggttcattttcttggttgcattatttttcaacctgcttgttatt
ttaacaacatttgcatcttgtacatcactgccttcgtccaaattgtttataggcttgatt
tctgtgtctaacttattcatgggaatctatactggcatcctaacttttcttgatgctgtg
tcctggggcagattcgctgaatttggcatttggtgggaaactggcagtggctgcaaagta
gctgggtttcttgcagttttctcctcagaaagtgccatatttttattaatgctagcaact
gtcgaaagaagcttatctgcaaaagatataatgaaaaatgggaagagcaatcatctcaaa
cagttccgggttgctgcccttttggctttcctaggtgctacagtagcaggctgttttccc
cttttccatagaggggaatattctgcatcacccctttgtttgccatttcctacaggtgaa
acgccatcattaggattcactgtaacgttagtgctattaaactcactagcatttttatta
atggccgttatctacactaagctatactgcaacttggaaaaagaggacctctcagaaaac
tcacaatctagcatgattaagcatgtcgcttggctaatcttcaccaattgcatctttttc
tgccctgtggcgtttttttcatttgcaccattgatcactgcaatctctatcagccccgaa
ataatgaagtctgttactctgatattttttccattgcctgcttgcctgaatccagtcctg
tatgttttcttcaacccaaagtttaaagaagactggaagttactgaagcgacgtgttacc
aagaaaagtggatcagtttcagtttccatcagtagccaaggtggttgtctggaacaggat
ttctactacgactgtggcatgtactcacatttgcagggcaacctgactgtttgcgactgc
tgcgaatcgtttcttttaacaaagccagtatcatgcaaacacttgataaaatcacacagc
tgtcctgcattggcagtggcttcttgccaaagacctgagggctactggtccgactgtggc
acacagtcggcccactctgattatgcagatgaagaagattcctttgtctcagacagttct
gaccaggtgcaggcctgtggacgagcctgcttctaccagagtagaggattccctttggtg
cgctatgcttacaatctaccaagagttaaagactga

DBGET integrated database retrieval system