KEGG   Homo sapiens (human): 55367Help
Entry
55367             CDS       T01001                                 

Gene name
PIDD1, LRDD, PIDD
Definition
p53-induced death domain protein 1
Orthology
K10130  
leucine-rich repeats and death domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    55367 (PIDD1)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    55367 (PIDD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 910 aa AA seqDB search
MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQ
LLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAG
LSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTH
NRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLR
SLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASP
DAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGATATPITIRYRL
LLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNS
WGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIF
PPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPS
GITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCV
GGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTV
EMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQ
VSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLG
DAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWA
ERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSS
APQPPEPAQA
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacggtggaggggccagagctggaggcagctgctgccgcaggagatgcttca
gaggattcggacgcagggtccagggcgctgcctttcctgggcggcaaccggctgagcttg
gacctgtaccccgggggctgccagcagctgctgcacctgtgtgtccagcagcctctgcag
ctgctgcaggtggaattcttgcgtctgagcactcacgaggaccctcagctgctggaggcc
accctggcccagctgcctcagagcctgtcctgcctccgctccctggtcctcaaaggaggg
caacgccgggacacactgggtgcctgtctccggggtgccctgaccaacctgcccgctggt
ctgagtggcctggcccatctggcccacctggacctgagcttcaacagcctggagacactg
ccggcctgtgtcctgcagatgcgaggtctgggtgcgctcttgctgtctcacaactgcctc
tctgagctgcctgaggctctgggggccctccccgccctcaccttcctcacagtgacacac
aaccgcctgcagacgctgcccccagcactgggggccctatccaccctgcagcgcctcgat
ctctctcagaatctgctggacacgctacctcctgagattggaggcctgggcagcctcctg
gagctcaacctggcctccaaccggctgcagagcctcccagcctctctggcgggacttcgg
tccttgcggctccttgtcctgcacagcaacctcctggcctctgtgccagctgacttggcc
cgccttccactcctcacccggctcgacctgagggacaaccagctccgggacctgccccct
gagctgctagacgccccctttgtgcgcctgcaggggaaccccctgggtgaggcctcgcca
gacgccccgagttcaccagtggcagccctcattccagaaatgcccagactgttcctgacc
tcagatttggacagctttcctgtgacccctcaaggctgctcagtgaccctggcctgtggc
gtccgcctgcagttcccagcgggagccaccgccacccccatcaccatccgctatcggctg
ctgctgccggagccaggcctcgtccccctgggtcctcatgacgccctgctcagccatgtg
ctggagctgcagccccatggggtggccttccagcaggatgtggggctgtggctgctcttc
accccaccgcaggcccggcgctgccgtgaagtggtggtcaggacccggaatgacaacagc
tggggtgacctggagacctacctggaggaagaggcaccccagcggctctgggctcactgc
caggtgccccacttctcctggttccttgtggtttcccgccctgtgtccaatgcctgcctg
gtgccaccggaggggacactgctgtgctcctcgggtcatcctggggtcaaagtcatcttc
ccccctggggccactgaggagcctcgtcgagtctccatgcaggtggtgcgcatggctggc
cgagagctgcaggccctcctgggagaaccagaggctgcagtgagccccctgctgtgcctg
tcacagagcggtccccccagcttcctccaaccggtcaccgtgcagctgcctctgccctct
ggcatcacaggcctcagtctggaccgctcccgcctgcacctgttgtactgggcccctcct
gcagccacctgggatgacatcacagctcaggtggtcctggagctcacccacctgtacgca
cgcttccaggtcacacacttctcctggtactggctctggtacaccaccaagaactgtgtg
ggaggcctggctcggaaggcctgggagcggctgcggctgcaccgtgtgaacctcatcgct
ctgcagcggcgccgggaccctgagcaggtcctgctgcagtgcctgccccgaaacaaggtg
gacgccacccttcggcggctgctggagcggtaccggggccccgagccctctgacacggtg
gagatgttcgagggcgaagagttctttgcggccttcgagcgcggcatcgacgtggatgct
gaccgccctgactgtgtggagggcagaatctgctttgtcttctactcgcacctgaagaat
gtgaaggaggtatacgtgaccaccactctggaccgggaggctcaggctgtgcggggccag
gtgtccttctaccgtggcgcggtgcctgtgcgggtgcccgaggaggctgaggctgcccgg
cagaggaagggcgcagacgccctgtggatggccactctgcccatcaagctgccgagactt
cgagggtccgaggggccacggcggggggctggcctctccttggcacccttgaatctggga
gatgccgagaccggctttctgacgcagagcaacctgctgagtgtggctgggcgtctgggt
ctggactggccagccgtggccctgcacctgggggtgtcctaccgggaggtgcagcgcatc
cggcacgagttccgggatgatctggatgagcagatccgtcacatgctcttctcctgggct
gagcgccaggctgggcagccaggggctgtggggctcctggtgcaggccctggagcagagt
gaccggcaggacgtggctgaagaggtgcgcgcagtcttggagctcggccgccgcaagtac
caggacagcatccgacgcatgggcttggcccccaaggaccccgctctgcctggctcctcg
gctccacagcccccagagcctgcccaggcctag

DBGET integrated database retrieval system