KEGG   Homo sapiens (human): 5537Help
Entry
5537              CDS       T01001                                 

Gene name
PPP6C, PP6, PP6C
Definition
(RefSeq) protein phosphatase 6 catalytic subunit (EC:3.1.3.16)
  KO
K15498  
serine/threonine-protein phosphatase 6 catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5537 (PPP6C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-6
    Catalytic subunits
     5537 (PPP6C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Protein phosphatase 6
     5537 (PPP6C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.3
AA seq 305 aa AA seqDB search
MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYD
LCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQIT
QVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIE
RNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLV
HEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTT
TPYFL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgctagacctggacaagtatgtggaaatagcgcggctgtgcaagtacctgcca
gagaacgacctgaagcggctatgtgactacgtttgtgacctcctcttagaagagtcaaat
gttcagccagtatcaacaccagtaacagtgtgtggagatatccatggacagttttatgac
ctttgtgaactgttcagaactggaggtcaggttcctgacacaaactacatatttatgggt
gattttgtagacagaggttactatagtttggagaccttcacttaccttcttgcattaaag
gctaaatggcctgatcgtattacacttttgcgaggaaatcatgagagtagacagataaca
caggtctatggattttatgatgagtgccaaaccaaatatggaaatgctaatgcctggaga
tactgtaccaaagtttttgacatgctcacagtagcagctttaatagatgagcagattttg
tgtgtccatggtggtttatctcctgatatcaaaacactggatcaaattcgaaccatcgaa
cggaatcaggaaattcctcataaaggagcattttgtgatctggtttggtcagatcctgaa
gatgtggatacctgggctatcagtccccgaggagcaggttggctttttggagcaaaggtc
acaaatgagtttgttcatatcaacaacttaaaactcatctgcagagcacatcaactagtg
cacgaaggctataaatttatgtttgatgagaagctggtgacagtatggtctgctcctaat
tactgctatcgttgtggaaatattgcttcgatcatggtcttcaaagatgtaaatacaaga
gaaccaaagttattccgggcagttccagattcagaacgtgttattcctcccagaacgaca
acgccatatttcctttga

DBGET integrated database retrieval system