KEGG   Homo sapiens (human): 5537Help
Entry
5537              CDS       T01001                                 

Gene name
PPP6C, PP6, PP6C
Definition
protein phosphatase 6, catalytic subunit (EC:3.1.3.16)
Orthology
K15498  
serine/threonine-protein phosphatase 6 catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.3
AA seq 342 aa AA seqDB search
MAPLDLDKYVEIARLCKYLPENDLKVSPICGLAPSGCGAPAGRPFLSPGPPPVFHFLRFL
KERLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFV
DRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCT
KVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVD
TWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCY
RCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgctagacctggacaagtatgtggaaatagcgcggctgtgcaagtacctgcca
gagaacgacctgaaggtgagccctatttgcgggctcgccccttccggctgtggggcgccc
gccggccggcccttcctttctccaggacccccgccggtatttcattttcttcgttttcta
aaggagcggctatgtgactacgtttgtgacctcctcttagaagagtcaaatgttcagcca
gtatcaacaccagtaacagtgtgtggagatatccatggacagttttatgacctttgtgaa
ctgttcagaactggaggtcaggttcctgacacaaactacatatttatgggtgattttgta
gacagaggttactatagtttggagaccttcacttaccttcttgcattaaaggctaaatgg
cctgatcgtattacacttttgcgaggaaatcatgagagtagacagataacacaggtctat
ggattttatgatgagtgccaaaccaaatatggaaatgctaatgcctggagatactgtacc
aaagtttttgacatgctcacagtagcagctttaatagatgagcagattttgtgtgtccat
ggtggtttatctcctgatatcaaaacactggatcaaattcgaaccatcgaacggaatcag
gaaattcctcataaaggagcattttgtgatctggtttggtcagatcctgaagatgtggat
acctgggctatcagtccccgaggagcaggttggctttttggagcaaaggtcacaaatgag
tttgttcatatcaacaacttaaaactcatctgcagagcacatcaactagtgcacgaaggc
tataaatttatgtttgatgagaagctggtgacagtatggtctgctcctaattactgctat
cgttgtggaaatattgcttcgatcatggtcttcaaagatgtaaatacaagagaaccaaag
ttattccgggcagttccagattcagaacgtgttattcctcccagaacgacaacgccatat
ttcctttga

DBGET integrated database retrieval system