KEGG   Homo sapiens (human): 5538Help
Entry
5538              CDS       T01001                                 

Gene name
PPT1, CLN1, INCL, PPT
Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Disease
H00149  
Neuronal ceroid lipofuscinosis
H00810  
Progressive myoclonic epilepsy (PME)
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:hsa00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32
AA seq 306 aa AA seqDB search
MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERL
VQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAH
IIPFLG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccggctgcctgtggctcttggctgtggctctcctgccatggacctgcgct
tctcgggcgctgcagcatctggacccgccggcgccgctgccgttggtgatctggcatggg
atgggagacagctgttgcaatcccttaagcatgggtgctattaaaaaaatggtggagaag
aaaatacctggaatttacgtcttatctttagagattgggaagaccctgatggaggacgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaacagtgtgtcaggcacttgct
aaggatcctaaattgcagcaaggctacaatgctatgggattctcccagggaggccaattt
ctgagggcagtggctcagagatgcccttcacctcccatgatcaatctgatctcggttggg
ggacaacatcaaggtgtttttggactccctcgatgcccaggagagagctctcacatctgt
gacttcatccgaaaaacactgaatgctggggcgtactccaaagttgttcaggaacgcctc
gtgcaagccgaatactggcatgaccccataaaggaggatgtgtatcgcaaccacagcatc
ttcttggcagatataaatcaggagcggggtatcaatgagtcctacaagaaaaacctgatg
gccctgaagaagtttgtgatggtgaaattcctcaatgattccattgtggaccctgtagat
tcggagtggtttggattttacagaagtggccaagccaaggaaaccattcccttacaggag
acctccctgtacacacaggaccgcctggggctaaaggaaatggacaatgcaggacagcta
gtgtttctggctacagaaggggaccatcttcagttgtctgaagaatggttttatgcccac
atcataccattccttggatga

DBGET integrated database retrieval system