KEGG   Homo sapiens (human): 5538Help
Entry
5538              CDS       T01001                                 

Gene name
PPT1, CLN1, INCL, PPT
Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Disease
H00149  
Neuronal ceroid lipofuscinosis
H00810  
Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    5538 (PPT1)
  Lipid metabolism
   00062 Fatty acid elongation
    5538 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    5538 (PPT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     5538 (PPT1)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   5538 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p32
AA seq 306 aa AA seqDB search
MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERL
VQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAH
IIPFLG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccggctgcctgtggctcttggctgtggctctcctgccatggacctgcgct
tctcgggcgctgcagcatctggacccgccggcgccgctgccgttggtgatctggcatggg
atgggagacagctgttgcaatcccttaagcatgggtgctattaaaaaaatggtggagaag
aaaatacctggaatttacgtcttatctttagagattgggaagaccctgatggaggacgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaacagtgtgtcaggcacttgct
aaggatcctaaattgcagcaaggctacaatgctatgggattctcccagggaggccaattt
ctgagggcagtggctcagagatgcccttcacctcccatgatcaatctgatctcggttggg
ggacaacatcaaggtgtttttggactccctcgatgcccaggagagagctctcacatctgt
gacttcatccgaaaaacactgaatgctggggcgtactccaaagttgttcaggaacgcctc
gtgcaagccgaatactggcatgaccccataaaggaggatgtgtatcgcaaccacagcatc
ttcttggcagatataaatcaggagcggggtatcaatgagtcctacaagaaaaacctgatg
gccctgaagaagtttgtgatggtgaaattcctcaatgattccattgtggaccctgtagat
tcggagtggtttggattttacagaagtggccaagccaaggaaaccattcccttacaggag
acctccctgtacacacaggaccgcctggggctaaaggaaatggacaatgcaggacagcta
gtgtttctggctacagaaggggaccatcttcagttgtctgaagaatggttttatgcccac
atcataccattccttggatga

DBGET integrated database retrieval system