KEGG   Homo sapiens (human): 55432Help
Entry
55432             CDS       T01001                                 

Gene name
YOD1, DUBA8, OTUD2, PRO0907
Definition
YOD1 deubiquitinase (EC:3.4.19.12)
Orthology
K13719  
ubiquitin thioesterase OTU1 [EC:3.1.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.2
AA seq 304 aa AA seqDB search
METLHIIYSEAKSFTVEGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGD
TILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTS
VYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIE
ISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLT
IFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTN
FGEV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaacattacatataatttattcagaagcaaagtcttttacagtggaggggctgtcc
agccggacccgggtgcgggaactccagggccaaattgccgccatcaccgggatcgccccc
ggcggtcagcgaatcctcgtcggataccctcccgagtgcctggatctcagcaatggggat
accattctggaagacttgcccatccaatctggtgacatgctgatcattgaagaagaccaa
accaggcccagaagttcacctgcatttactaaacgtggtgcttctagttacgtcagggaa
actttgcctgtgcttaccagaaccgtggtcccagcagacaactcttgcctctttactagt
gtgtactatgtcgtcgaaggaggagtcttgaatccagcttgtgcccctgagatgagacgc
ctcatagcacaaattgtagcaagcgatccagacttctatagtgaggcaatactgggaaaa
acaaatcaagagtactgtgactggatcaaaagggatgacacttggggaggagcaatagag
atatcgattttgtccaagttttaccaatgtgaaatatgtgtagtggatacacagacagta
agaattgatcgttttggggaagatgcaggatataccaaaagggttctgcttatttatgat
ggcatccactatgatccacttcagcgtaacttccctgatccagatacacctcctctgacc
attttctcctctaatgatgatattgttcttgtacaagcactggaattagcagatgaagct
agaagaaggagacagtttactgatgtcaaccgcttcaccctgagatgcatggtatgtcag
aaaggattaactggacaagcagaagcaagggaacatgccaaggagacaggccataccaac
tttggagaagtgtga

DBGET integrated database retrieval system