KEGG   Homo sapiens (human): 55432Help
Entry
55432             CDS       T01001                                 

Gene name
YOD1, DUBA8, OTUD2, PRO0907
Definition
(RefSeq) YOD1 deubiquitinase (EC:3.4.19.12)
  KO
K13719  
ubiquitin thioesterase OTU1 [EC:3.1.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    55432 (YOD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     55432 (YOD1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C88
   55432 (YOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.2
AA seq 348 aa AA seqDB search
MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVL
QGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLII
EEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAP
EMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVD
TQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALEL
ADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtttggccccgctaaaggtcgccattttggagtccacccggcgcctggtttccccggc
ggcgtctcccaacaggctgccgggaccaaagctggccccgcgggtgcctggcctgtgggc
agccggaccgacacgatgtggcggctccgctgcaaggccaaggacggcacccatgttttg
caggggctgtccagccggacccgggtgcgggaactccagggccaaattgccgccatcacc
gggatcgcccccggcggtcagcgaatcctcgtcggataccctcccgagtgcctggatctc
agcaatggggataccattctggaagacttgcccatccaatctggtgacatgctgatcatt
gaagaagaccaaaccaggcccagaagttcacctgcatttactaaacgtggtgcttctagt
tacgtcagggaaactttgcctgtgcttaccagaaccgtggtcccagcagacaactcttgc
ctctttactagtgtgtactatgtcgtcgaaggaggagtcttgaatccagcttgtgcccct
gagatgagacgcctcatagcacaaattgtagcaagcgatccagacttctatagtgaggca
atactgggaaaaacaaatcaagagtactgtgactggatcaaaagggatgacacttgggga
ggagcaatagagatatcgattttgtccaagttttaccaatgtgaaatatgtgtagtggat
acacagacagtaagaattgatcgttttggggaagatgcaggatataccaaaagggttctg
cttatttatgatggcatccactatgatccacttcagcgtaacttccctgatccagataca
cctcctctgaccattttctcctctaatgatgatattgttcttgtacaagcactggaatta
gcagatgaagctagaagaaggagacagtttactgatgtcaaccgcttcaccctgagatgc
atggtatgtcagaaaggattaactggacaagcagaagcaagggaacatgccaaggagaca
ggccataccaactttggagaagtgtga

DBGET integrated database retrieval system