KEGG   Homo sapiens (human): 55437Help
Entry
55437             CDS       T01001                                 

Gene name
STRADB, ALS2CR2, CALS-21, ILPIP, ILPIPA, PAPK, PRO1038
Definition
(RefSeq) STE20-related kinase adaptor beta
  KO
K17532  
STE20-related kinase adapter protein beta
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    55437 (STRADB)
   04150 mTOR signaling pathway
    55437 (STRADB)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   55437 (STRADB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33.1
AA seq 418 aa AA seqDB search
MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYEL
QVEIGRGFDNLTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNIT
TYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGC
IHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQ
DLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESR
MKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSA
SSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttttggattgcttctgcacttcaagaacacaagttgaatcactcagacctgaa
aaacagtctgaaaccagtatccatcaatacttggttgatgagccaaccctttcctggtca
cgtccatccactagagccagtgaagtactatgttccaccaacgtttctcactatgagctc
caagtagaaataggaagaggatttgacaacttgacttctgtccatcttgcacggcatact
cccacaggaacactggtaactataaaaattacaaatctggaaaactgcaatgaagaacgc
ctgaaagctttacagaaagccgtgattctatcccactttttccggcatcccaatattaca
acttattggacagttttcactgttggcagctggctttgggttatttctccatttatggcc
tatggttcagcaagtcaactcttgaggacctattttcctgaaggaatgagtgaaacttta
ataagaaacattctctttggagccgtgagagggttgaactatctgcaccaaaatggctgt
attcacaggagtattaaagccagccatatcctcatttctggtgatggcctagtgaccctc
tctggcctgtcccatctgcatagtttggttaagcatggacagaggcatagggctgtgtat
gatttcccacagttcagcacatcagtgcagccgtggctgagtccagaactactgagacag
gatttacatgggtataatgtgaagtcagatatttacagtgttgggattacagcatgtgaa
ttagccagtgggcaggtgcctttccaggacatgcatagaactcagatgctgttacagaaa
ctgaaaggtcctccttatagcccattggatatcagtattttccctcaatcagaatccaga
atgaaaaattcccagtcaggtgtagactctgggattggagaaagtgtgcttgtctccagt
ggaactcacacagtaaatagtgaccgattacacacaccatcctcaaaaactttctctcct
gccttctttagcttggtacagctctgtttgcaacaagatcctgagaaaaggccatcagca
agcagtttattgtcccatgttttcttcaaacagatgaaagaagaaagccaggattcaata
ctttcactgttgcctcctgcttataacaagccatcaatatcattgcctccagtgttacct
tggactgagccagaatgtgattttcctgatgaaaaagactcatactgggaattctag

DBGET integrated database retrieval system