KEGG   Homo sapiens (human): 5547Help
Entry
5547              CDS       T01001                                 

Gene name
PRCP, HUMPCP, PCP
Definition
(RefSeq) prolylcarboxypeptidase (EC:3.4.16.2)
  KO
K01285  
lysosomal Pro-X carboxypeptidase [EC:3.4.16.2]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    5547 (PRCP)
  Digestive system
   04974 Protein digestion and absorption
    5547 (PRCP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.2  lysosomal Pro-Xaa carboxypeptidase
     5547 (PRCP)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S28
   5547 (PRCP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q14
AA seq 496 aa AA seqDB search
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgagccctcctgctcctgcttctgtcttttctggcgccctgggccaccata
gccctccggccggccttaagggccctcggcagcctacacttgccaaccaaccccacatcc
ctcccggctgtagccaagaactattcggttctctacttccaacagaaggttgatcatttt
ggatttaatactgtgaaaacttttaatcagcggtacctagtagctgataaatactggaag
aaaaatggtggatcaatacttttctacactggtaatgaaggggacattatctggttttgt
aataacacggggttcatgtgggatgtggctgaggaactgaaagctatgttggtgtttgct
gaacatcgatactatggagagtctctcccctttggtgacaactcattcaaggattccaga
cacttgaatttcctgacatcagaacaagctctggctgattttgcagagttaatcaaacac
ttgaaaagaacaatcccaggagctgaaaatcaacctgtcattgccataggaggctcctat
ggtggcatgcttgccgcctggtttaggatgaaatatcctcatatggtagttggagctctt
gcagcttctgcccctatctggcagtttgaggatttagtaccttgtggtgtatttatgaag
atcgtaactacagattttaggaaaagcggtccacattgttcagagagcatccacaggtcc
tgggatgccattaatcgactctcaaatactggcagtggtttgcagtggcttactggagcc
cttcacttatgcagcccattaacttctcaggacatccaacatttgaaagactggatctct
gaaacctgggtgaatctggcaatggtggactatccttatgcctctaactttttacagcct
ttgcctgcttggcctatcaaggtagtgtgccagtatttgaaaaatcccaatgtatctgat
tcactgctgctgcagaatattttccaagctctgaatgtatattacaattattcgggccag
gtgaaatgcctgaatatttcagagacagcaactagcagtctgggaacactgggttggagc
tatcaggcctgcacagaagtagtcatgcccttttgtactaatggtgtcgatgacatgttt
gaacctcactcatggaacttaaaggaactttctgatgactgttttcaacagtggggtgtg
agaccaaggccctcctggatcactactatgtatggaggcaaaaacattagttcacacaca
aacattgttttcagcaatggtgaactagacccctggtcaggaggtggagtaactaaggat
atcacagacactctggttgcagtcaccatctcagagggggcccaccacttagatctccgc
accaagaatgccttggatcctatgtctgtgctgttagcccgctccttggaagttagacat
atgaagaattggatcagagatttctatgacagtgcgggaaagcagcactga

DBGET integrated database retrieval system