KEGG   Homo sapiens (human): 55504Help
Entry
55504             CDS       T01001                                 

Gene name
TNFRSF19, TAJ, TAJ-alpha, TRADE, TROY
Definition
tumor necrosis factor receptor superfamily, member 19
Orthology
K05155  
tumor necrosis factor receptor superfamily member 19
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.11-q12.3
AA seq 417 aa AA seqDB search
MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSK
ECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPG
FYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALAT
VLLALLILCVIYCKRQFMEKKPSWSLRSQDIQYNGSELSCFDRPQLHEYAHRACCQCRRD
SVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQARNAGPAGEMVPTFFGSLTQSI
CGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSNSSQDLVGGAV
PVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQEA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaaagtgctactagaacaagagaaaacgtttttcactcttttagtattacta
ggctatttgtcatgtaaagtgacttgtgaatcaggagactgtagacagcaagaattcagg
gatcggtctggaaactgtgttccctgcaaccagtgtgggccaggcatggagttgtctaag
gaatgtggcttcggctatggggaggatgcacagtgtgtgacgtgccggctgcacaggttc
aaggaggactggggcttccagaaatgcaagccctgtctggactgcgcagtggtgaaccgc
tttcagaaggcaaattgttcagccaccagtgatgccatctgcggggactgcttgccagga
ttttataggaagacgaaacttgtcggctttcaagacatggagtgtgtgccttgtggagac
cctcctcctccttacgaaccgcactgtgccagcaaggtcaacctcgtgaagatcgcgtcc
acggcctccagcccacgggacacggcgctggctgccgttatctgcagcgctctggccacc
gtcctgctggccctgctcatcctctgtgtcatctattgtaagagacagtttatggagaag
aaacccagctggtctctgcggtcacaggacattcagtacaacggctctgagctgtcgtgt
tttgacagacctcagctccacgaatatgcccacagagcctgctgccagtgccgccgtgac
tcagtgcagacctgcgggccggtgcgcttgctcccatccatgtgctgtgaggaggcctgc
agccccaacccggcgactcttggttgtggggtgcattctgcagccagtcttcaggcaaga
aacgcaggcccagccggggagatggtgccgactttcttcggatccctcacgcagtccatc
tgtggcgagttttcagatgcctggcctctgatgcagaatcccatgggtggtgacaacatc
tctttttgtgactcttatcctgaactcactggagaagacattcattctctcaatccagaa
cttgaaagctcaacgtctttggattcaaatagcagtcaagatttggttggtggggctgtt
ccagtccagtctcattctgaaaactttacagcagctactgatttatctagatataacaac
acactggtagaatcagcatcaactcaggatgcactaactatgagaagccagctagatcag
gagagtggtgctgtcatccacccagccactcagacgtccctccaggaagcttaa

DBGET integrated database retrieval system