KEGG   Homo sapiens (human): 55505Help
Entry
55505             CDS       T01001                                 

Gene name
NOP10, DKCB1, NOLA3, NOP10P
Definition
NOP10 ribonucleoprotein
Orthology
K11130  
H/ACA ribonucleoprotein complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Module
H/ACA ribonucleoprotein complex
Disease
H00507  
Dyskeratosis congenita (DC)
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:hsa03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q14-q15
AA seq 64 aa AA seqDB search
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
RPVL
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccagtattacctcaacgagcagggagatcgagtctatacgctgaagaaattt
gacccgatgggacaacagacctgctcagcccatcctgctcggttctccccagatgacaaa
tactctcgacaccgaatcaccatcaagaaacgcttcaaggtgctcatgacccagcaaccg
cgccctgtcctctga

DBGET integrated database retrieval system