KEGG   Homo sapiens (human): 55505Help
Entry
55505             CDS       T01001                                 

Gene name
NOP10, DKCB1, NOLA3, NOP10P
Definition
(RefSeq) NOP10 ribonucleoprotein
  KO
K11130  H/ACA ribonucleoprotein complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Module
hsa_M00425  H/ACA ribonucleoprotein complex
Disease
H00507  Dyskeratosis congenita (DC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55505 (NOP10)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Sno RNPs
   Box H/ACA snoRNPs
    55505 (NOP10)
 Prokaryotic Type
    55505 (NOP10)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     55505 (NOP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop10p
Motif
Other DBs
NCBI-GeneID: 55505
NCBI-ProteinID: NP_061118
OMIM: 606471
HGNC: 14378
Ensembl: ENSG00000182117
Vega: OTTHUMG00000129440
Pharos: Q9NPE3(Tbio)
UniProt: Q9NPE3
Position
15q14
AA seq 64 aa AA seqDB search
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
RPVL
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccagtattacctcaacgagcagggagatcgagtctatacgctgaagaaattt
gacccgatgggacaacagacctgctcagcccatcctgctcggttctccccagatgacaaa
tactctcgacaccgaatcaccatcaagaaacgcttcaaggtgctcatgacccagcaaccg
cgccctgtcctctga

DBGET integrated database retrieval system