KEGG   Homo sapiens (human): 55532Help
Entry
55532             CDS       T01001                                 

Gene name
SLC30A10, HMDPC, ZNT10, ZNT8, ZRC1, ZnT-10
Definition
solute carrier family 30, member 10
Orthology
K14697  
solute carrier family 30 (zinc transporter), member 10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q41
AA seq 485 aa AA seqDB search
MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG
VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA
DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG
VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK
ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ
DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV
NRTHF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctactctggcaagacgtgccggctgctcttcatgctggtgctcaccgtcgcc
ttcttcgtggcggagctggtctccggctacctgggcaactccatcgcgctgctctccgac
tccttcaacatgctctccgacctgatctcgctgtgcgtgggcctgagcgccggctacatc
gcccggcgccccacccggggcttcagcgccacctacggctacgcccgcgccgaggtggtg
ggcgcgctgagcaacgcggtcttcctcaccgcgctctgcttcaccatcttcgtggaggcc
gtgctgcgcctggcccggcccgagcgcatcgatgaccccgagctggtgctcatcgtcggc
gtcctggggctgttggtcaacgtggtggggctgctcatcttccaggactgcgccgcctgg
ttcgcgtgctgcctccggggacgcagtcgccgcctgcagcagcggcagcagctggcggag
ggctgtgtccccggcgctttcggggggcctcagggcgcggaggacccgcggcgcgcggcg
gacccgacagccccaggctcggactcggccgtaaccctccgggggacctcggtggaaagg
aagcgggagaagggggcgaccgtgttcgcaaacgtagcaggtgattccttcaacacccag
aatgagccagaagacatgatgaaaaaagagaaaaagtctgaagctctgaatatcagaggt
gtacttttgcatgtgatgggagatgccctggggtccgtggttgtggtcatcacggccatc
atattctatgtgcttcccctgaagagtgaggacccgtgtaactggcagtgttacattgac
cccagcctgactgtcctcatggtcatcatcattttgtcatctgccttcccgcttatcaag
gagaccgctgccattctgctacagatggtcccaaaaggagtcaacatggaagagctgatg
agtaaactctctgctgtgcctggaattagcagtgtacatgaagtgcacatctgggaactt
gtaagtggaaagattattgccaccctgcacatcaagtatcctaaggacaggggatatcaa
gatgccagcacaaaaattcgagaaatcttccaccatgcgggaatccacaatgtgaccatc
cagtttgaaaatgtggacttgaaggaacccctggagcagaaggacttactgttgctctgc
aactcaccctgcatctccaagggctgtgctaagcagctgtgttgtccccccggggcactg
cctctggctcacgtcaatggctgtgctgagcacaatggtgggccctctctagacacatac
ggaagtgatggcctcagtagaagagacgcaagagaagtggctattgaagtgtctttggat
agctgtctgagtgaccacggacaaagtcttaacaaaactcaggaggaccaatgttatgtc
aacagaacgcatttttaa

DBGET integrated database retrieval system