KEGG   Homo sapiens (human): 55532Help
Entry
55532             CDS       T01001                                 

Gene name
SLC30A10, HMDPC, ZNT10, ZNT8, ZRC1, ZnT-10
Definition
solute carrier family 30, member 10
Orthology
K14697  
solute carrier family 30 (zinc transporter), member 10
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1q41
AA seq 485 aa AA seqDB search
MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG
VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA
DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG
VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK
ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ
DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV
NRTHF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctactctggcaagacgtgccggctgctcttcatgctggtgctcaccgtcgcc
ttcttcgtggcggagctggtctccggctacctgggcaactccatcgcgctgctctccgac
tccttcaacatgctctccgacctgatctcgctgtgcgtgggcctgagcgccggctacatc
gcccggcgccccacccggggcttcagcgccacctacggctacgcccgcgccgaggtggtg
ggcgcgctgagcaacgcggtcttcctcaccgcgctctgcttcaccatcttcgtggaggcc
gtgctgcgcctggcccggcccgagcgcatcgatgaccccgagctggtgctcatcgtcggc
gtcctggggctgttggtcaacgtggtggggctgctcatcttccaggactgcgccgcctgg
ttcgcgtgctgcctccggggacgcagtcgccgcctgcagcagcggcagcagctggcggag
ggctgtgtccccggcgctttcggggggcctcagggcgcggaggacccgcggcgcgcggcg
gacccgacagccccaggctcggactcggccgtaaccctccgggggacctcggtggaaagg
aagcgggagaagggggcgaccgtgttcgcaaacgtagcaggtgattccttcaacacccag
aatgagccagaagacatgatgaaaaaagagaaaaagtctgaagctctgaatatcagaggt
gtacttttgcatgtgatgggagatgccctggggtccgtggttgtggtcatcacggccatc
atattctatgtgcttcccctgaagagtgaggacccgtgtaactggcagtgttacattgac
cccagcctgactgtcctcatggtcatcatcattttgtcatctgccttcccgcttatcaag
gagaccgctgccattctgctacagatggtcccaaaaggagtcaacatggaagagctgatg
agtaaactctctgctgtgcctggaattagcagtgtacatgaagtgcacatctgggaactt
gtaagtggaaagattattgccaccctgcacatcaagtatcctaaggacaggggatatcaa
gatgccagcacaaaaattcgagaaatcttccaccatgcgggaatccacaatgtgaccatc
cagtttgaaaatgtggacttgaaggaacccctggagcagaaggacttactgttgctctgc
aactcaccctgcatctccaagggctgtgctaagcagctgtgttgtccccccggggcactg
cctctggctcacgtcaatggctgtgctgagcacaatggtgggccctctctagacacatac
ggaagtgatggcctcagtagaagagacgcaagagaagtggctattgaagtgtctttggat
agctgtctgagtgaccacggacaaagtcttaacaaaactcaggaggaccaatgttatgtc
aacagaacgcatttttaa

DBGET integrated database retrieval system