KEGG   Homo sapiens (human): 55540Help
Entry
55540             CDS       T01001                                 

Gene name
IL17RB, CRL4, EVI27, IL17BR, IL17RH1
Definition
interleukin 17 receptor B
Orthology
K05165  
interleukin 17 receptor B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    55540 (IL17RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.1
AA seq 502 aa AA seqDB search
MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATG
DYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWT
FSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLW
DPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVT
GDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLV
ATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICYFTEFLQNHCR
SEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ
DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELL
HVKQQVSAGKRSQACHDGCCSL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgtgctgctaagcctggccgcgctgtgcaggagcgccgtaccccgagagccg
accgttcaatgtggctctgaaactgggccatctccagagtggatgctacaacatgatcta
atccccggagacttgagggacctccgagtagaacctgttacaactagtgttgcaacaggg
gactattcaattttgatgaatgtaagctgggtactccgggcagatgccagcatccgcttg
ttgaaggccaccaagatttgtgtgacgggcaaaagcaacttccagtcctacagctgtgtg
aggtgcaattacacagaggccttccagactcagaccagaccctctggtggtaaatggaca
ttttcctacatcggcttccctgtagagctgaacacagtctatttcattggggcccataat
attcctaatgcaaatatgaatgaagatggcccttccatgtctgtgaatttcacctcacca
ggctgcctagaccacataatgaaatataaaaaaaagtgtgtcaaggccggaagcctgtgg
gatccgaacatcactgcttgtaagaagaatgaggagacagtagaagtgaacttcacaacc
actcccctgggaaacagatacatggctcttatccaacacagcactatcatcgggttttct
caggtgtttgagccacaccagaagaaacaaacgcgagcttcagtggtgattccagtgact
ggggatagtgaaggtgctacggtgcagctgactccatattttcctacttgtggcagcgac
tgcatccgacataaaggaacagttgtgctctgcccacaaacaggcgtccctttccctctg
gataacaacaaaagcaagccgggaggctggctgcctctcctcctgctgtctctgctggtg
gccacatgggtgctggtggcagggatctatctaatgtggaggcacgaaaggatcaagaag
acttccttttctaccaccacactactgccccccattaaggttcttgtggtttacccatct
gaaatatgtttccatcacacaatttgttacttcactgaatttcttcaaaaccattgcaga
agtgaggtcatccttgaaaagtggcagaaaaagaaaatagcagagatgggtccagtgcag
tggcttgccactcaaaagaaggcagcagacaaagtcgtcttccttctttccaatgacgtc
aacagtgtgtgcgatggtacctgtggcaagagcgagggcagtcccagtgagaactctcaa
gacctcttcccccttgcctttaaccttttctgcagtgatctaagaagccagattcatctg
cacaaatacgtggtggtctactttagagagattgatacaaaagacgattacaatgctctc
agtgtctgccccaagtaccacctcatgaaggatgccactgctttctgtgcagaacttctc
catgtcaagcagcaggtgtcagcaggaaaaagatcacaagcctgccacgatggctgctgc
tccttgtag

DBGET integrated database retrieval system