KEGG   Homo sapiens (human): 55593Help
Entry
55593             CDS       T01001                                 

Gene name
OTUD5, DUBA
Definition
OTU deubiquitinase 5 (EC:3.4.19.12)
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    55593 (OTUD5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     55593 (OTUD5)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   55593 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.23
AA seq 566 aa AA seqDB search
MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGAR
PRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAA
AAGVGAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDE
YEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMH
EVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQ
YSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLM
KNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPS
QPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALA
KPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASV
LAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgactatactccccaaaaagaagccgccgcctcccgacgccgaccccgccaacgagccg
ccgccgcccgggccgatgcccccggcgccgcggcgcggcggaggtgtgggcgtgggcggc
ggcggcacgggcgtgggcggcggcgatcgcgaccgtgactccggcgtcgtgggggcccgt
ccgcgagcttcgccaccgcctcaaggcccgctaccaggaccgccgggcgctcttcatcgc
tgggcgctggccgtgccgcctggtgcagtggcgggtccccggccacaacaggcttctcca
cctccttgcgggggcccaggtggtcccggcggcggtcccggcgacgcgctgggcgcagcg
gcggcgggtgtgggtgccgcgggcgtggtggtgggtgtgggtggtgccgtaggcgtgggc
ggctgctgctccgggcctgggcacagcaagcggcgacgtcaagctcccggggttggcgcg
gttggcgggggcagtcccgagcgtgaggaggtcggcgcaggctacaacagtgaggacgag
tatgaggcggctgcagcacgcatcgaggctatggaccctgccactgtcgagcagcaggag
cattggtttgaaaaggccctacgagacaagaagggcttcatcatcaagcagatgaaggag
gatggcgcctgtctcttccgggctgtagctgaccaggtgtatggagaccaggacatgcat
gaggttgtgcgaaagcattgcatggactatctgatgaagaatgccgactacttctccaac
tatgtcacagaggactttaccacctacattaacaggaagcggaaaaacaattgccatggc
aaccacattgagatgcaggccatggcagagatgtacaaccgtcctgtggaggtgtaccag
tacagcacagaacccatcaacacattccatgggatacatcaaaacgaggacgaacccatt
cgtgttagctaccatcggaatatccactataattcagtggtgaatcctaacaaggccacc
attggtgtggggctgggcctgccatcattcaaaccagggtttgcagagcagtctctgatg
aagaatgccataaaaacatcggaggagtcatggattgaacagcagatgctagaagacaag
aaacgggccacagactgggaggccacaaatgaagccatcgaggagcaggtggctcgggaa
tcctacctgcagtggttgcgggatcaggagaaacaggctcgccaggtccgaggccccagc
cagccccggaaagccagcgccacatgcagttcggccacagcagcagcctccagtggcctg
gaggagtggactagccggtccccgcggcagcggagttcagcctcgtcacctgagcaccct
gagctgcatgctgaattgggcatgaagcccccttccccaggcactgttttagctcttgcc
aaacctccttcgccctgtgcgccaggtacaagcagtcagttctcggcaggggccgaccgg
gcaacttccccccttgtgtccctctaccctgctttggagtgccgggccctcattcagcag
atgtccccctctgcctttggtctgaatgactgggatgatgatgagatcctagcttcggtg
ctggcagtgtcccaacaggaatacctagacagtatgaagaaaaacaaagtgcacagagac
ccgcccccagacaagagttga

DBGET integrated database retrieval system