KEGG   Homo sapiens (human): 55651Help
Entry
55651             CDS       T01001                                 

Gene name
NHP2, DKCB2, NHP2P, NOLA2
Definition
NHP2 ribonucleoprotein
Orthology
K11129  
H/ACA ribonucleoprotein complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Module
H/ACA ribonucleoprotein complex
Disease
H00507  
Dyskeratosis congenita (DC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55651 (NHP2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (Animals)
    Dyskerin complex
     55651 (NHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.3
AA seq 90 aa AA seqDB search
MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQI
RRGVKEVQKFVNKGEKGTWVQPQAPSAPPV
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaataaaggcagatcccgacgggcccgaggctcaggcggaggcgtgttccggg
gagcgcacctaccaggagctgctggtcaaccagaaccccatcgcgcagcccctggcttct
cgccgcctcacgcggaagctctacaaatgcatcaagaaagcggtgaagcagaagcagatt
cggcgcggggtgaaagaggttcagaaatttgtcaacaaaggagaaaaagggacctgggtg
cagccgcaggctccaagcgccccacctgtgtga

DBGET integrated database retrieval system