KEGG   Homo sapiens (human): 55658Help
Entry
55658             CDS       T01001                                 

Gene name
RNF126
Definition
(RefSeq) ring finger protein 126
  KO
K11982  
E3 ubiquitin-protein ligase RNF115/126 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     55658 (RNF126)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    55658 (RNF126)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 311 aa AA seqDB search
MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQ
SRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRH
RYGARQPRARLTTRRATGRHEGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYA
WGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYALGE
RVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTGVSFSSSSSSSSSS
SPSNENATSNS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgtcgccgcatcccggacggtacttctgccactgctgctccgtggagatc
gtcccgcgcctgccggattatatctgtccaagatgcgagtctggttttatcgaggagctt
ccggaagagaccaggagcacagaaaatggttctgccccctccacagctcccacagaccag
agccggccaccgttggagcacgtggaccagcacctgttcacgctgccgcagggctacgga
cagtttgctttcggcatcttcgatgacagcttcgagatccccacgttccctcctggggcg
caggctgacgacggcagggaccctgagagccggcgggagagagaccatccgtcccggcac
cggtacggcgcccgacagccccgcgcccgcctcaccacgcggcgggccaccggccggcac
gaaggcgtccccacgctggaagggatcatccagcagctcgtcaacggcatcatcacgccc
gccaccatccccagcctgggcccctggggagtcctgcactcaaaccctatggactacgcc
tggggggccaacggcctggatgccatcatcacacagctcctcaatcagtttgaaaacaca
ggccccccaccggcagataaagagaaaatccaggccctccccaccgtccccgtcactgag
gagcacgtaggctccgggctcgagtgccctgtgtgcaaggacgactacgcgctgggtgag
cgtgtgcggcagctgccctgcaaccacctgttccacgacggctgcatcgtgccctggctg
gagcagcacgacagctgccccgtctgccgaaaaagcctcacgggacagaacacggccacg
aacccccctggcctcactggggtgagcttctcctcctcgtcgtcatcgtcctcctccagc
tcgcccagcaacgagaacgccacaagcaactcgtga

DBGET integrated database retrieval system