KEGG   Homo sapiens (human): 55658Help
Entry
55658             CDS       T01001                                 

Gene name
RNF126
Definition
ring finger protein 126
Orthology
K11982  
E3 ubiquitin-protein ligase RNF115/126 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     55658 (RNF126)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 311 aa AA seqDB search
MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQ
SRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRH
RYGARQPRARLTTRRATGRHEGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYA
WGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYALGE
RVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTGVSFSSSSSSSSSS
SPSNENATSNS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgtcgccgcatcccggacggtacttctgccactgctgctccgtggagatc
gtcccgcgcctgccggattatatctgtccaagatgcgagtctggttttatcgaggagctt
ccggaagagaccaggagcacagaaaatggttctgccccctccacagctcccacagaccag
agccggccaccgttggagcacgtggaccagcacctgttcacgctgccgcagggctacgga
cagtttgctttcggcatcttcgatgacagcttcgagatccccacgttccctcctggggcg
caggctgacgacggcagggaccctgagagccggcgggagagagaccatccgtcccggcac
cggtacggcgcccgacagccccgcgcccgcctcaccacgcggcgggccaccggccggcac
gaaggcgtccccacgctggaagggatcatccagcagctcgtcaacggcatcatcacgccc
gccaccatccccagcctgggcccctggggagtcctgcactcaaaccctatggactacgcc
tggggggccaacggcctggatgccatcatcacacagctcctcaatcagtttgaaaacaca
ggccccccaccggcagataaagagaaaatccaggccctccccaccgtccccgtcactgag
gagcacgtaggctccgggctcgagtgccctgtgtgcaaggacgactacgcgctgggtgag
cgtgtgcggcagctgccctgcaaccacctgttccacgacggctgcatcgtgccctggctg
gagcagcacgacagctgccccgtctgccgaaaaagcctcacgggacagaacacggccacg
aacccccctggcctcactggggtgagcttctcctcctcgtcgtcatcgtcctcctccagc
tcgcccagcaacgagaacgccacaagcaactcgtga

DBGET integrated database retrieval system