KEGG   Homo sapiens (human): 5566Help
Entry
5566              CDS       T01001                                 

Gene name
PRKACA, PKACA, PPNAD4
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Autophagy - animal
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Apelin signaling pathway
Tight junction
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Vibrio cholerae infection
Amoebiasis
Human papillomavirus infection
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy (DCM)
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5566 (PRKACA)
   04010 MAPK signaling pathway
    5566 (PRKACA)
   04310 Wnt signaling pathway
    5566 (PRKACA)
   04340 Hedgehog signaling pathway
    5566 (PRKACA)
   04371 Apelin signaling pathway
    5566 (PRKACA)
   04020 Calcium signaling pathway
    5566 (PRKACA)
   04024 cAMP signaling pathway
    5566 (PRKACA)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5566 (PRKACA)
  Cell growth and death
   04114 Oocyte meiosis
    5566 (PRKACA)
  Cellular community - eukaryotes
   04530 Tight junction
    5566 (PRKACA)
   04540 Gap junction
    5566 (PRKACA)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5566 (PRKACA)
   04062 Chemokine signaling pathway
    5566 (PRKACA)
  Endocrine system
   04911 Insulin secretion
    5566 (PRKACA)
   04910 Insulin signaling pathway
    5566 (PRKACA)
   04922 Glucagon signaling pathway
    5566 (PRKACA)
   04923 Regulation of lipolysis in adipocyte
    5566 (PRKACA)
   04912 GnRH signaling pathway
    5566 (PRKACA)
   04913 Ovarian Steroidogenesis
    5566 (PRKACA)
   04915 Estrogen signaling pathway
    5566 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    5566 (PRKACA)
   04921 Oxytocin signaling pathway
    5566 (PRKACA)
   04926 Relaxin signaling pathway
    5566 (PRKACA)
   04918 Thyroid hormone synthesis
    5566 (PRKACA)
   04919 Thyroid hormone signaling pathway
    5566 (PRKACA)
   04916 Melanogenesis
    5566 (PRKACA)
   04924 Renin secretion
    5566 (PRKACA)
   04925 Aldosterone synthesis and secretion
    5566 (PRKACA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5566 (PRKACA)
   04270 Vascular smooth muscle contraction
    5566 (PRKACA)
  Digestive system
   04970 Salivary secretion
    5566 (PRKACA)
   04971 Gastric acid secretion
    5566 (PRKACA)
   04976 Bile secretion
    5566 (PRKACA)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5566 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5566 (PRKACA)
  Nervous system
   04724 Glutamatergic synapse
    5566 (PRKACA)
   04727 GABAergic synapse
    5566 (PRKACA)
   04725 Cholinergic synapse
    5566 (PRKACA)
   04728 Dopaminergic synapse
    5566 (PRKACA)
   04726 Serotonergic synapse
    5566 (PRKACA)
   04720 Long-term potentiation
    5566 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    5566 (PRKACA)
  Sensory system
   04740 Olfactory transduction
    5566 (PRKACA)
   04742 Taste transduction
    5566 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    5566 (PRKACA)
  Aging
   04211 Longevity regulating pathway - mammal
    5566 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    5566 (PRKACA)
  Environmental adaptation
   04713 Circadian entrainment
    5566 (PRKACA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5566 (PRKACA)
   05205 Proteoglycans in cancer
    5566 (PRKACA)
   05203 Viral carcinogenesis
    5566 (PRKACA)
  Neurodegenerative diseases
   05012 Parkinson's disease
    5566 (PRKACA)
   05020 Prion diseases
    5566 (PRKACA)
  Substance dependence
   05030 Cocaine addiction
    5566 (PRKACA)
   05031 Amphetamine addiction
    5566 (PRKACA)
   05032 Morphine addiction
    5566 (PRKACA)
   05034 Alcoholism
    5566 (PRKACA)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5566 (PRKACA)
  Infectious diseases
   05110 Vibrio cholerae infection
    5566 (PRKACA)
   05166 HTLV-I infection
    5566 (PRKACA)
   05169 Epstein-Barr virus infection
    5566 (PRKACA)
   05165 Human papillomavirus infection
    5566 (PRKACA)
   05146 Amoebiasis
    5566 (PRKACA)
  Drug resistance
   01522 Endocrine resistance
    5566 (PRKACA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5566 (PRKACA)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   5566 (PRKACA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5566 (PRKACA)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5566 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P17612(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.12
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagaattctta
gccaaagccaaagaagattttcttaaaaaatgggaaagtcccgctcagaacacagcccac
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaaacacaaggagaccgggaaccactatgccatgaagatcctcgacaaacagaaggtg
gtgaaactgaaacagatcgaacacaccctgaatgaaaagcgcatcctgcaagctgtcaac
tttccgttcctcgtcaaactcgagttctccttcaaggacaactcaaacttatacatggtc
atggagtacgtgcccggcggggagatgttctcacacctacggcggatcggaaggttcagt
gagccccatgcccgtttctacgcggcccagatcgtcctgacctttgagtatctgcactcg
ctggatctcatctacagggacctgaagccggagaatctgctcattgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
ggcacccctgagtacctggcccctgagattatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctgggggttcttatctatgaaatggccgctggctacccgcccttcttc
gcagaccagcccatccagatctatgagaagatcgtctctgggaaggtgcgcttcccttcc
cacttcagctctgacttgaaggacctgctgcggaacctcctgcaggtagatctcaccaag
cgctttgggaacctcaagaatggggtcaacgatatcaagaaccacaagtggtttgccaca
actgactggattgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggatacgagtaactttgacgactatgaggaagaagaaatccgggtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Homo sapiens (human): 5567Help
Entry
5567              CDS       T01001                                 

Gene name
PRKACB, PKA_C-beta, PKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Autophagy - animal
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Apelin signaling pathway
Tight junction
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Vibrio cholerae infection
Amoebiasis
Human papillomavirus infection
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy (DCM)
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5567 (PRKACB)
   04010 MAPK signaling pathway
    5567 (PRKACB)
   04310 Wnt signaling pathway
    5567 (PRKACB)
   04340 Hedgehog signaling pathway
    5567 (PRKACB)
   04371 Apelin signaling pathway
    5567 (PRKACB)
   04020 Calcium signaling pathway
    5567 (PRKACB)
   04024 cAMP signaling pathway
    5567 (PRKACB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5567 (PRKACB)
  Cell growth and death
   04114 Oocyte meiosis
    5567 (PRKACB)
  Cellular community - eukaryotes
   04530 Tight junction
    5567 (PRKACB)
   04540 Gap junction
    5567 (PRKACB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5567 (PRKACB)
   04062 Chemokine signaling pathway
    5567 (PRKACB)
  Endocrine system
   04911 Insulin secretion
    5567 (PRKACB)
   04910 Insulin signaling pathway
    5567 (PRKACB)
   04922 Glucagon signaling pathway
    5567 (PRKACB)
   04923 Regulation of lipolysis in adipocyte
    5567 (PRKACB)
   04912 GnRH signaling pathway
    5567 (PRKACB)
   04913 Ovarian Steroidogenesis
    5567 (PRKACB)
   04915 Estrogen signaling pathway
    5567 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    5567 (PRKACB)
   04921 Oxytocin signaling pathway
    5567 (PRKACB)
   04926 Relaxin signaling pathway
    5567 (PRKACB)
   04918 Thyroid hormone synthesis
    5567 (PRKACB)
   04919 Thyroid hormone signaling pathway
    5567 (PRKACB)
   04916 Melanogenesis
    5567 (PRKACB)
   04924 Renin secretion
    5567 (PRKACB)
   04925 Aldosterone synthesis and secretion
    5567 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5567 (PRKACB)
   04270 Vascular smooth muscle contraction
    5567 (PRKACB)
  Digestive system
   04970 Salivary secretion
    5567 (PRKACB)
   04971 Gastric acid secretion
    5567 (PRKACB)
   04976 Bile secretion
    5567 (PRKACB)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5567 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5567 (PRKACB)
  Nervous system
   04724 Glutamatergic synapse
    5567 (PRKACB)
   04727 GABAergic synapse
    5567 (PRKACB)
   04725 Cholinergic synapse
    5567 (PRKACB)
   04728 Dopaminergic synapse
    5567 (PRKACB)
   04726 Serotonergic synapse
    5567 (PRKACB)
   04720 Long-term potentiation
    5567 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    5567 (PRKACB)
  Sensory system
   04740 Olfactory transduction
    5567 (PRKACB)
   04742 Taste transduction
    5567 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    5567 (PRKACB)
  Aging
   04211 Longevity regulating pathway - mammal
    5567 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    5567 (PRKACB)
  Environmental adaptation
   04713 Circadian entrainment
    5567 (PRKACB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5567 (PRKACB)
   05205 Proteoglycans in cancer
    5567 (PRKACB)
   05203 Viral carcinogenesis
    5567 (PRKACB)
  Neurodegenerative diseases
   05012 Parkinson's disease
    5567 (PRKACB)
   05020 Prion diseases
    5567 (PRKACB)
  Substance dependence
   05030 Cocaine addiction
    5567 (PRKACB)
   05031 Amphetamine addiction
    5567 (PRKACB)
   05032 Morphine addiction
    5567 (PRKACB)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5567 (PRKACB)
  Infectious diseases
   05110 Vibrio cholerae infection
    5567 (PRKACB)
   05166 HTLV-I infection
    5567 (PRKACB)
   05169 Epstein-Barr virus infection
    5567 (PRKACB)
   05165 Human papillomavirus infection
    5567 (PRKACB)
   05146 Amoebiasis
    5567 (PRKACB)
  Drug resistance
   01522 Endocrine resistance
    5567 (PRKACB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5567 (PRKACB)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   5567 (PRKACB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5567 (PRKACB)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5567 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P22694(Tchem)
UniProt: 
Position
1p31.1
AA seq 351 aa AA seqDB search
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcggcgaccgccaagaaaggcagcgaggtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttttgaaaaaatgggagaatccaactcagaataatgccgga
cttgaagattttgaaaggaaaaaaacccttggaacaggttcatttggaagagtcatgttg
gtaaaacacaaagccactgaacagtattatgccatgaagatcttagataagcagaaggtt
gttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacaggcagtgaat
tttcctttccttgttcgactggagtatgcttttaaggataattctaatttatacatggtt
atggaatatgtccctgggggtgaaatgttttcacatctaagaagaattggaaggttcagt
gagccccatgcacggttctatgcagctcagatagtgctaacattcgagtacctccattca
ctagacctcatctacagagatctaaaacctgaaaatctcttaattgaccatcaaggctat
atccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttggacattatgt
ggaactccagagtatttggctccagaaataattctcagcaagggctacaataaggcagtg
gattggtgggcattaggagtgctaatctatgaaatggcagctggctatcccccattcttt
gcagaccaaccaattcagatttatgaaaagattgtttctggaaaggtccgattcccatcc
cacttcagttcagatctcaaggaccttctacggaacctgctgcaggtggatttgaccaag
agatttggaaatctaaagaatggtgtcagtgatataaaaactcacaagtggtttgccacg
acagattggattgctatttaccagaggaaggttgaagctccattcataccaaagtttaga
ggctctggagataccagcaactttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtgcaaaagaatttggtgaattttaa

KEGG   Homo sapiens (human): 5568Help
Entry
5568              CDS       T01001                                 

Gene name
PRKACG, BDPLT19, KAPG, PKACg
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit gamma
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Autophagy - animal
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Apelin signaling pathway
Tight junction
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Vibrio cholerae infection
Amoebiasis
Human papillomavirus infection
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy (DCM)
Module
cAMP signaling
Disease
H01740  
Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5568 (PRKACG)
   04010 MAPK signaling pathway
    5568 (PRKACG)
   04310 Wnt signaling pathway
    5568 (PRKACG)
   04340 Hedgehog signaling pathway
    5568 (PRKACG)
   04371 Apelin signaling pathway
    5568 (PRKACG)
   04020 Calcium signaling pathway
    5568 (PRKACG)
   04024 cAMP signaling pathway
    5568 (PRKACG)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    5568 (PRKACG)
  Cell growth and death
   04114 Oocyte meiosis
    5568 (PRKACG)
  Cellular community - eukaryotes
   04530 Tight junction
    5568 (PRKACG)
   04540 Gap junction
    5568 (PRKACG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    5568 (PRKACG)
   04062 Chemokine signaling pathway
    5568 (PRKACG)
  Endocrine system
   04911 Insulin secretion
    5568 (PRKACG)
   04910 Insulin signaling pathway
    5568 (PRKACG)
   04922 Glucagon signaling pathway
    5568 (PRKACG)
   04923 Regulation of lipolysis in adipocyte
    5568 (PRKACG)
   04912 GnRH signaling pathway
    5568 (PRKACG)
   04913 Ovarian Steroidogenesis
    5568 (PRKACG)
   04915 Estrogen signaling pathway
    5568 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    5568 (PRKACG)
   04921 Oxytocin signaling pathway
    5568 (PRKACG)
   04926 Relaxin signaling pathway
    5568 (PRKACG)
   04918 Thyroid hormone synthesis
    5568 (PRKACG)
   04919 Thyroid hormone signaling pathway
    5568 (PRKACG)
   04916 Melanogenesis
    5568 (PRKACG)
   04924 Renin secretion
    5568 (PRKACG)
   04925 Aldosterone synthesis and secretion
    5568 (PRKACG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5568 (PRKACG)
   04270 Vascular smooth muscle contraction
    5568 (PRKACG)
  Digestive system
   04970 Salivary secretion
    5568 (PRKACG)
   04971 Gastric acid secretion
    5568 (PRKACG)
   04976 Bile secretion
    5568 (PRKACG)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    5568 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5568 (PRKACG)
  Nervous system
   04724 Glutamatergic synapse
    5568 (PRKACG)
   04727 GABAergic synapse
    5568 (PRKACG)
   04725 Cholinergic synapse
    5568 (PRKACG)
   04728 Dopaminergic synapse
    5568 (PRKACG)
   04726 Serotonergic synapse
    5568 (PRKACG)
   04720 Long-term potentiation
    5568 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    5568 (PRKACG)
  Sensory system
   04740 Olfactory transduction
    5568 (PRKACG)
   04742 Taste transduction
    5568 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    5568 (PRKACG)
  Aging
   04211 Longevity regulating pathway - mammal
    5568 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    5568 (PRKACG)
  Environmental adaptation
   04713 Circadian entrainment
    5568 (PRKACG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5568 (PRKACG)
   05205 Proteoglycans in cancer
    5568 (PRKACG)
   05203 Viral carcinogenesis
    5568 (PRKACG)
  Neurodegenerative diseases
   05012 Parkinson's disease
    5568 (PRKACG)
   05020 Prion diseases
    5568 (PRKACG)
  Substance dependence
   05030 Cocaine addiction
    5568 (PRKACG)
   05031 Amphetamine addiction
    5568 (PRKACG)
   05032 Morphine addiction
    5568 (PRKACG)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5568 (PRKACG)
  Infectious diseases
   05110 Vibrio cholerae infection
    5568 (PRKACG)
   05166 HTLV-I infection
    5568 (PRKACG)
   05169 Epstein-Barr virus infection
    5568 (PRKACG)
   05165 Human papillomavirus infection
    5568 (PRKACG)
   05146 Amoebiasis
    5568 (PRKACG)
  Drug resistance
   01522 Endocrine resistance
    5568 (PRKACG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     5568 (PRKACG)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   5568 (PRKACG)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5568 (PRKACG)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5568 (PRKACG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P22612(Tbio)
UniProt: 
Position
9q21.11
AA seq 351 aa AA seqDB search
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcccccgccaagaaggacaccgagcaggaggagagcgtgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggctcaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccaggagaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcacatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaagctccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gagccccatgcctgtttctatgccgcccaggtcgtcctggccgtccagtacctacactcg
ctcgacctcatccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccgtgggcttcccacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaagcatctgctgcggagcctgctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accagctggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaagagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system