KEGG   Homo sapiens (human): 55663Help
Entry
55663             CDS       T01001                                 

Gene name
ZNF446, ZKSCAN20, ZSCAN30, ZSCAN52
Definition
(RefSeq) zinc finger protein 446
  KO
K09229  KRAB and SCAN domains-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    55663 (ZNF446)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCAN KRAB zf-C2H2 zf-C2H2_4 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 55663
NCBI-ProteinID: NP_060378
HGNC: 21036
Ensembl: ENSG00000083838
Vega: OTTHUMG00000183541
Pharos: Q9NWS9(Tdark)
UniProt: Q9NWS9 Q9UFF2
Position
19q13.43
AA seq 450 aa AA seqDB search
MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQEVAGPREALARLRELCCQWLQPEAH
SKEQMLEMLVLEQFLGTLPPEIQAWVRGQRPGSPEEAAALVEGLQHDPGQLLGWITAHVL
KQEVLPAAQKTEEPLGSPHPSGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPS
SPPLAAQSPEGNHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLP
PHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATP
APTVRPGTPPVPTQPTPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIHHRTHTSGPGV
QSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEECGCSFSWKSQLVIHRKSHTGQ
RRHFCSDCGRAFDWKSQLVIHRKGHRPEVP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccctctgggtcccccatgcctgcccgtcatggacccagagaccacccttgag
gagcctgagactgcccgcctccgcttccgagggttctgctaccaggaggtggcaggtccc
cgagaagccctggcccggctgcgtgagctgtgttgccagtggctgcagcctgaggcacac
tccaaggagcagatgctggagatgctggtgctggagcagttcctgggcacactgcctccc
gagatccaggcctgggtgcgcggtcagcggccaggcagtcctgaggaggccgctgcccta
gtcgaaggactgcagcatgaccctgggcaactgttgggctggatcacagcccatgtcctg
aagcaggaggtgctccctgcagcccagaagacagaggaaccacttgggagcccccacccc
tcagggacagtggagtcccctggggaaggtccccaggacaccagaatagaggggtctgtc
cagctcagctgcagtgtgaaggaggagcccaatgtcgatggacaggaagtggcaccctcc
agccctccacttgcagcacagtcccctgaggggaaccatggacaccaagaaccagcctcc
acatccttccacccacccaggattcaggaggagtgggggctgctggaccggtcacagaag
gaactgtactgggatgcgatgctggagaagtacggcacagtggtctccctggggttaccg
ccccaccagccagaggcacaggcccagtcagagctggggatgctgctcacggggacaggc
gtctgcagaagcctgcgctcgggaaatgagagtgagggtccacctggctgcccagaggcc
cagccgccccagggcccagggccggcagcctgggagggcttgtctggggctgccactcct
gcccccactgtgcgcccagggacaccgccagtgcccactcagcccacacctgcagagacg
agactggagccggctgccacccccaggaagccctacacgtgcgagcagtgtggccgcggc
ttcgactggaagtcagtgttcgtcatccaccaccggacacacacgagtgggccaggtgtg
cagtccccggggctagccaccggggaaagcacagagaagccaccacaaggggaggtggcc
tttccgcaccacccccgacgctcactcacaggcccccggagttacccgtgtgaggagtgc
gggtgcagcttcagctggaagtcgcagctggtcatccaccgcaagagccacacaggccag
cggcgtcacttctgcagtgactgtggccgcgccttcgactggaagtcgcagctggtcatc
caccgcaagggccaccggccggaggttccatga

DBGET integrated database retrieval system