KEGG   Homo sapiens (human): 55687Help
Entry
55687             CDS       T01001                                 

Gene name
TRMU, MTO2, MTU1, TRMT, TRMT1, TRNT1
Definition
tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase (EC:2.1.1.61)
Orthology
K00566  
tRNA-specific 2-thiouridylase [EC:2.8.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Sulfur relay system
Disease
H01367  
Infantile liver failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    55687 (TRMU)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.-  
     55687 (TRMU)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    55687 (TRMU)
 Prokaryotic Type
    55687 (TRMU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13
AA seq 307 aa AA seqDB search
MMCSGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQT
FFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLL
QYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPR
TDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWV
TAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDG
PGLSPLL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgttcaggggcagatgccattgccacaggtcactatgcaagaacttccctggaa
gatgaagaagtctttgagcagaagcacgttaagaagcccgaagggcttttcagaaatcgg
tttgaagttagaaatgcggtaaaactcctccaggcagctgacagctttaaagaccagacc
ttctttctcagccaggtttcccaggatgccctgaggagaaccatcttccctctgggggga
ttaacgaaagagtttgtaaagaaaatcgctgctgagaatagacttcatcatgtgcttcag
aagaaagagagcatgggcatgtgtttcatcgggaagaggaattttgaacatttccttctt
cagtatctgcagcctcgacctggtcactttatttccatagaagacaataaggttctggga
acacataaaggttggttcctgtataccttgggccagagagcaaacataggtggcctgaga
gagccctggtacgtggtggagaaggacagcgtcaagggtgacgtgtttgtggccccccgg
acagaccacccagccctgtacagggacctgctgaggaccagccgcgtgcactggattgcg
gaggagcctcccgcagcactggtccgggacaagatgatggagtgccacttccgattccgc
caccagatggcactagtgccctgtgtgctgaccctcaatcaagatggcaccgtgtgggtg
acagctgtgcaggctgtgcgtgcccttgccacaggacagtttgctgtgttctacaagggg
gacgagtgcctgggcagcgggaagatcctgcggctggggccgtctgcctacacgctccag
aagggccagcgcagagctgggatggccactgagagccccagtgacagcccagaagatggt
ccaggcctgagtcccttgctctga

DBGET integrated database retrieval system