KEGG   Homo sapiens (human): 55687Help
Entry
55687             CDS       T01001                                 

Gene name
TRMU, LCAL3, MTO2, MTU1, TRMT, TRMT1, TRNT1
Definition
(RefSeq) tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase
  KO
K21027  
tRNA-5-taurinomethyluridine 2-sulfurtransferase [EC:2.8.1.14]
Organism
hsa  Homo sapiens (human)
Disease
H01367  
Infantile liver failure
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.14  tRNA-5-taurinomethyluridine 2-sulfurtransferase
     55687 (TRMU)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    55687 (TRMU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
O75648(Tbio)
UniProt: 
Position
22q13.31
AA seq 421 aa AA seqDB search
MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRV
CQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGA
DAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQV
SQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPR
PGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPAL
YRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAV
RALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPL
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccttgcggcacgtcgtgtgcgccctgtccggcggcgtggacagcgccgtggcc
gcgctgctgctgaggcggagaggttaccaggtgacaggggtgtttatgaagaactgggac
tcactggatgaacatggggtctgtactgccgacaaagactgtgaagatgcttacagagtt
tgccagatcttagacatccctttccatcaagtgtcctacgtaaaggagtattggaatgat
gtgttcagtgactttttgaatgagtatgaaaaaggaaggactcccaatcctgacatagtt
tgcaacaagcacatcaaatttagttgcttttttcattatgctgtggataatcttggggca
gatgccattgccacaggtcactatgcaagaacttccctggaagatgaagaagtctttgag
cagaagcacgttaagaagcccgaagggcttttcagaaatcggtttgaagttagaaatgcg
gtaaaactcctccaggcagctgacagctttaaagaccagaccttctttctcagccaggtt
tcccaggatgccctgaggagaaccatcttccctctggggggattaacgaaagagtttgta
aagaaaatcgctgctgagaatagacttcatcatgtgcttcagaagaaagagagcatgggc
atgtgtttcatcgggaagaggaattttgaacatttccttcttcagtatctgcagcctcga
cctggtcactttatttccatagaagacaataaggttctgggaacacataaaggttggttc
ctgtataccttgggccagagagcaaacataggtggcctgagagagccctggtacgtggtg
gagaaggacagcgtcaagggtgacgtgtttgtggccccccggacagaccacccagccctg
tacagggacctgctgaggaccagccgcgtgcactggattgcggaggagcctcccgcagca
ctggtccgggacaagatgatggagtgccacttccgattccgccaccagatggcactagtg
ccctgtgtgctgaccctcaatcaagatggcaccgtgtgggtgacagctgtgcaggctgtg
cgtgcccttgccacaggacagtttgctgtgttctacaagggggacgagtgcctgggcagc
gggaagatcctgcggctggggccgtctgcctacacgctccagaagggccagcgcagagct
gggatggccactgagagccccagtgacagcccagaagatggtccaggcctgagtcccttg
ctctga

DBGET integrated database retrieval system