KEGG   Homo sapiens (human): 5569Help
Entry
5569              CDS       T01001                                 

Gene name
PKIA, PRKACN1
Definition
(RefSeq) cAMP-dependent protein kinase inhibitor alpha
  KO
K15985  
cAMP-dependent protein kinase inhibitor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    5569 (PKIA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P61925(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
8q21.13
AA seq 76 aa AA seqDB search
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS
TEQSGEAQGEAAKSES
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgtggaaactacatatgcagattttattgcttcaggaagaacaggtagaaga
aatgcaatacatgatatcctggtttcctctgcaagtggcaacagcaatgaattagccttg
aaattagcaggtcttgatatcaacaagacagaaggtgaagaagatgcacaacgaagttct
acagaacaaagtggggaagcccagggagaagcagcaaaatctgaaagctaa

DBGET integrated database retrieval system