KEGG   Homo sapiens (human): 55696Help
Entry
55696             CDS       T01001                                 

Gene name
RBM22, Cwc2, ZC3H16, fSAP47
Definition
RNA binding motif protein 22
Orthology
K12872  
pre-mRNA-splicing factor RBM22/SLT11
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    55696 (RBM22)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    55696 (RBM22)
 Complex C
    55696 (RBM22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q33.1
AA seq 420 aa AA seqDB search
MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPG
VRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQN
MEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECP
YRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG
DTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAV
VNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctctctgggttccaacacctacaacaggcagaactgggaggatgcggacttc
cccattctgtgccagacatgtcttggagaaaacccatatatccgaatgaccaaagaaaag
tatgggaaggaatgcaaaatctgtgccaggccattcacagtgtttcgctggtgccctgga
gtccgcatgcgtttcaagaagactgaagtgtgccaaacctgcagtaaattgaagaatgtc
tgtcagacctgcctcttagacctagagtatggcctgcccatccaggttcgtgacgcagga
ttgtcttttaaagatgacatgccaaagtcagatgtcaacaaagagtactatacacagaat
atggagagagagatttctaactctgatggaacacggccagttggcatgctggggaaagcc
acatctaccagtgacatgctgctcaaactggcccggaccacaccctactacaaaaggaat
cgaccccacatttgctccttctgggtgaaaggagagtgtaagagaggagaggaatgtcca
tacagacatgagaagcctacagatccagatgacccccttgctgatcagaatattaaagac
cgttattacggaatcaatgatcctgtagctgacaagcttctaaagcgggcttcaacaatg
cctcggctggacccaccagaggataaaactatcaccacactatatgttggtggtctaggt
gataccattactgagacagatttaagaaatcatttctaccagttcggagagatccggacg
atcactgttgtgcagagacagcagtgtgctttcatccagtttgccacacggcaggctgca
gaagtggctgctgagaagtcctttaataagttgattgtaaatggccgcagactgaatgtg
aaatggggaagatcccaggcagccagaggaaaagaaaaagagaaagatggaactacagac
tctgggatcaaactagaacctgttccaggattgccaggagctcttcctcctcctcctgca
gcagaagaagaagcctctgccaactacttcaacttgcccccaagtggtcctccagctgtg
gtgaacattgctctgccaccgccccctggcattgctccacccccacccccaggttttggg
ccacacatgttccacccaatgggaccaccccctcctttcatgcgggctccaggaccaatc
cactatccttctcaggaccctcagaggatgggagctcatgctggaaaacacagcagcccc
tag

DBGET integrated database retrieval system