KEGG   Homo sapiens (human): 55697Help
Entry
55697             CDS       T01001                                 

Gene name
VAC14, ArPIKfyve, TAX1BP2, TRX
Definition
Vac14 homolog (S. cerevisiae)
Orthology
K15305  
vacuole morphology and inheritance protein 14
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    55697 (VAC14)
  Infectious diseases
   05166 HTLV-I infection
    55697 (VAC14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 782 aa AA seqDB search
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVSFIPLL
RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKEIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDELDELRPGQRQAEPTPDDALPKQ
EGTASGGPDGSCDSSFSSGISVFTAASTERAPVTLHLDGIVQVLNCHLSDTAIGMMTRIA
VLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEIASSPAGQTDDP
GPLDGPDLQASHSELQVPTPGRAGLLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFSS
ERKLLEVRGPFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHALNTILLTSTELF
QLRNQLKDLKTLESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTVD
FLAEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCV
PNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRV
VL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgagaaggatttcgcgccgctcacgcctaacatcgtgcgcgccctcaatgac
aagctgtacgaaaagcggaaggtggcagcgctggagatcgagaagctggtccgggagttc
gtggcccagaacaataccgtgcaaatcaagcatgtgatccagaccctgtcccaggagttt
gccctgtctcagcacccccacagccggaaagggggcctcatcggcctggccgcctgctcc
atcgcactgggcaaggactcagggctctacctgaaggagctgatcgagccagtgctgacc
tgcttcaatgatgcagacagcaggctgcgctactatgcctgcgaggccctctacaacatc
gtcaaggtggcccggggcgctgtgctgccccacttcaacgtgctctttgacgggctgagc
aagctggcagccgacccagaccccaatgtgaaaagcggatctgagctcctagaccgcctt
ttaaaggacattgtgactgagagcaacaagtttgacctggtgagcttcatccccttgttg
cgagagaggatttactccaacaaccagtatgcccggcagttcatcatctcctggatcctg
gttctggagtcggtgccagacattaacctgctggattacctgccggagatcctggatgga
ctcttccagatcctgggtgacaatggcaaagagattcgcaaaatgtgtgaggttgttctt
ggagaattcttaaaagaaattaagaagaacccctccagtgtgaagtttgctgagatggcc
aacatcctggtgatccactgccagacaacagatgacctcatccagctgacagccatgtgc
tggatgcgggagttcatccagctggcgggccgcgtcatgctgccttactcctccgggatc
ctgactgctgtcttgccctgcttggcctacgatgaccgcaagaaaagcatcaaagaagtg
gccaacgtgtgcaaccagagcctgatgaagctggtcacccccgaggacgacgagctggat
gagctgagacctgggcagaggcaggcagagcccacccctgacgatgccctgccaaagcag
gagggcacagccagtggaggtccagatggttcctgtgactccagcttcagtagcggcatc
agtgtcttcactgcagccagcactgaaagagccccagtgacccttcacctcgacgggatc
gtgcaggtcctaaactgccacctcagtgacacggccattgggatgatgaccaggattgca
gttctcaagtggctctaccacctctacatcaaaactcctcggaagatgttccggcacacg
gacagcctctttcccatcctactgcagacgttatcggatgaatcggatgaggtgatcctg
aaggacctggaggtgctggcagaaatcgcttcctcccccgcaggccagacggatgaccca
ggccccctcgatggccctgacctccaggccagccactcagagctccaggtgcccacccct
ggcagagccggcctactgaacacctctggtaccaaaggcttagaatgttctccttcaact
cccaccatgaattcttacttttataagttcatgatcaaccttctcaagagattcagcagc
gaacggaagctcctggaggtcagaggccctttcatcatcaggcagctgtgcctcctgctg
aatgcggagaacatcttccactcaatggcagacatcctgctgcgggaggaggacctcaag
ttcgcctcgaccatggtccacgccctcaacaccatcctgctgacctccacagagctcttc
cagctaaggaaccagctgaaggacctgaagaccctggagagccagaacctgttctgctgc
ctgtaccgctcctggtgccacaacccagtcaccacggtgtccctctgcttcctcacccag
aactaccggcacgcctatgacctcatccagaagtttggggacctggaggtcaccgtggac
ttcctcgcagaggtggacaagctggtgcagctgattgagtgccccatcttcacatatctg
cgcctgcagctgctggacgtgaagaacaacccctacctgatcaaggccctctacggcctg
ctcatgctcctgccgcagagcagcgccttccagctgctctcgcaccggctccagtgcgtg
cccaaccctgagctgctgcagaccgaagacagtctaaaggcagcccccaagtcccagaaa
gctgactcccctagcatcgactacgcagagctgctgcagcactttgagaaggtccagaac
aagcacctggaagtgcggcaccagcggagcgggcgtggggaccacctggaccggagggtt
gtcctctga

DBGET integrated database retrieval system