KEGG   Homo sapiens (human): 55699Help
Entry
55699             CDS       T01001                                 

Gene name
IARS2, ILERS
Definition
isoleucyl-tRNA synthetase 2, mitochondrial (EC:6.1.1.5)
Orthology
K01870  
isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    55699 (IARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     55699 (IARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   55699 (IARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    55699 (IARS2)
 Prokaryotic Type
   Other AARSs
    55699 (IARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q41
AA seq 1012 aa AA seqDB search
MRWGLRPRGPGAAALATARSLWGTPRLPCSPGWQGATKRLLVRSVSGASNHQPNSNSGRY
RDTVLLPQTSFPMKLLGRQQPDTELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANG
DPHVGHALNKILKDIANRFHMMNGSKIHFVPGWDCHGLPIEIKVLSELGREAQNLSAMEI
RKKARSFAKAAIEKQKSAFIRWGIMADWNNCYYTFDGKYEAKQLRTFYQMYDKGLVYRSY
KPVFWSPSSRTALAEAELEYNPEHVSRSIYVKFPLLKPSPKLASLIDGSSPVSILVWTTQ
PWTIPANEAVCYMPESKYAVVKCSKSGDLYVLAADKVASVASTLETTFETISTLSGVDLE
NGTCSHPLIPDKASPLLPANHVTMAKGTGLVHTAPAHGMEDYGVASQHNLPMDCLVDEDG
VFTDVAGPELQNKAVLEEGTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPVVIRASKQ
WFINITDIKTAAKELLKKVKFIPGSALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTK
DEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQDILDIW
FDSGTSWSYVLPGPDQRADLYLEGKDQLGGWFQSSLLTSVAARKRAPYKTVIVHGFTLGE
KGEKMSKSLGNVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAAR
DDISKLRNTLRFLLGNVADFNPETDSIPVNDMYVIDQYMLHLLQDLANKITELYKQYDFG
KVVRLLRTFYTRELSNFYFSIIKDRLYCEKENDPKRRSCQTALVEILDVIVRSFAPILPH
LAEEVFQHIPYIKEPKSVFRTGWISTSSIWKKPGLEEAVESACAMRDSFLGSIPGKNAAE
YKVITVIEPGLLFEIIEMLQSEETSSTSQLNELMMASESTLLAQEPREMTADVIELKGKF
LINLEGGDIREESSYKVIVMPTTKEKCPRCWKYTAESSDTLCPRCAEVVSGK
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgggggctgcgccctcgcgggccgggcgcggccgccctggccactgcccgaagt
ttgtgggggacgccccgccttccctgcagcccgggatggcaaggggcgacgaagaggctt
ctggtgcggtcggtctccggggccagtaaccaccagccgaactcgaatagtggcagatac
cgggacacggtgctgctgccgcagacgagcttccccatgaagctgctgggccgccagcag
ccggacacggagctggagatccagcagaaatgtggattttcagaactttattcatggcaa
agagaaagaaaagtaaagacagaattttgccttcatgatggacctccttatgcaaacggt
gaccctcatgttggacatgctttaaataagattttgaaagacatagccaatcgattccat
atgatgaatggctccaaaatacattttgtgcccggctgggattgtcatgggttgcccatt
gaaataaaagtattatcagaacttggtagagaagctcagaatctttcagctatggaaatt
agaaagaaagctagatcatttgctaaagcagccattgagaaacagaaatcagcatttatt
cgttggggaataatggcagattggaataattgctactatacatttgatgggaagtatgaa
gccaaacagttgagaactttttaccaaatgtatgataagggcttggtttatcgatcttac
aaacctgtgttttggtctccgtcatctaggactgcattggctgaagcagaacttgaatat
aatcctgagcatgtcagtcgttcaatatatgtaaaatttcctctcttaaagccttctcca
aaattggcatctcttatagatggttcatctcctgttagtattttggtctggaccacacaa
ccttggacgattccagccaatgaagctgtttgctatatgcctgaatcaaagtatgctgtt
gtgaaatgttctaagtctggagacctctacgtactggcggcagataaagtagcatctgtt
gcttctactttggaaacaacatttgagactatttcaacactttcaggtgtagatttggaa
aatggtacttgcagtcatccattaattcctgataaagcctctcctcttttacctgcaaat
catgtgaccatggcaaaaggaacgggattggttcacacagccccagctcatggtatggaa
gactacggtgtagcgtctcagcacaacctgcccatggattgtctagtggacgaagatgga
gttttcacagatgttgcaggtcctgaacttcaaaacaaggctgtccttgaagagggaact
gatgtggttataaagatgcttcagactgcaaagaatttgttgaaagaggagaaattggtg
catagctatccgtatgactggaggaccaagaaacctgtggttattcgtgccagcaagcag
tggtttataaacatcacggatattaagactgcagccaaggaattgttaaaaaaggtgaaa
tttattcctggatcagcactgaatggcatggttgaaatgatggacaggcggccatattgg
tgtatatcaaggcaaagagtttggggtgttccaattcctgtgtttcatcataagaccaag
gatgaatacttgatcaacagccaaaccactgagcatattgttaaactagtggaacaacac
ggcagtgatatctggtggactcttccccctgaacaacttcttccaaaagaagtcttatct
gaggttggtggccctgatgccttggaatatgtgccaggtcaggatattttggacatctgg
tttgatagcggaacttcatggtcttatgttcttccaggtcctgaccaaagagcagatttg
tacttggaaggaaaagaccagctcgggggttggtttcagtcatccttattaacaagtgtg
gcagcaaggaagagagcaccttataagacagtgattgttcatggatttacccttggagaa
aagggagaaaagatgtccaagtctcttgggaatgtcattcatcctgatgttgtcgttaat
ggaggacaagatcaaagcaaagagcctccgtatggtgctgatgtccttcgctggtgggta
gctgattccaatgtcttcaccgaagttgcaattggcccatccgtgctcaatgctgccaga
gatgatattagcaagcttaggaatacacttcgctttcttttgggaaatgtggctgatttc
aacccagaaacagattccatccctgtaaacgatatgtatgtcatagaccagtacatgcta
cacttactgcaggatttggcaaacaagattaccgaattatacaaacaatatgattttgga
aaagttgttcggctgttacggacgttttataccagagagctctctaacttttatttcagt
ataatcaaagataggctctattgtgaaaaggaaaatgaccccaaacgacgctcttgtcag
actgcattagttgaaattttggatgtaatagttcgttcttttgctcccattcttcctcac
ctggctgaagaggtgttccagcacataccttatattaaagagcccaagagtgttttccgt
actgggtggattagtactagttctatctggaaaaagcccgggttggaagaagctgtggag
agtgcgtgtgcaatgcgagactcatttcttggaagcatccctggcaaaaatgcagctgag
tacaaggttatcactgtgatagaacctggactgctttttgagataatagagatgctgcag
tctgaagagacttccagcacctctcagttgaatgaattaatgatggcttctgagtcaact
ttactggctcaggaaccacgagagatgactgcagatgtaatcgagcttaaagggaaattc
ctcatcaacttagaaggtggtgatattcgtgaagagtcttcctataaagtaattgtcatg
ccgactacgaaagaaaaatgcccccgttgttggaagtatacagcggagtcttcagataca
ctgtgtcctcgatgtgcagaagttgtcagtggaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system