KEGG   Homo sapiens (human): 55706Help
Entry
55706             CDS       T01001                                 

Gene name
NDC1, NET3, TMEM48
Definition
NDC1 transmembrane nucleoporin
Orthology
K14315  
nucleoporin NDC1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32.3
AA seq 634 aa AA seqDB search
MATAVSRPCAGRSRDILWRVLGWRIVASIVWSVLFLPICTTVFIIFSRIDLFHPIQWLSD
SFSDLYSSYVIFYFLLLSVVIIIISIFNVEFYAVITQGQYSFLVVPCTGTNSFGSPAAQT
CLNEYHLFFLLTGAFMGYSYSLLYFVNNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVES
LFLVRNFCILYYFLGYIPKAWISTAMNLHIDEQVHRPLDTVSGLLNLSLLYHVWLCGVFL
LTTWYVSWILFKIYATEAHVFPVQPPFAEGSDECLPKVLNSNPPPIIKYLALQDLMLLSQ
YSPSRRQEVFSLSQPGGHPHNWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVE
PKKLNSPEETAFQTPKSSQMPRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMA
GIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYS
WIQNKREQIKNFLSKRVLIMYFFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDR
FGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVDTSYKTLRFAFRASLKT
AIYRITTTFGEHLNAVQASAEHQKRLQQFLEFKE
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggccacggccgtgagccggccctgcgccggcaggtcgcgggacatactgtggcgcgtt
ttgggctggaggatagttgcaagtattgtttggtcagtgctatttctacccatctgcacc
acagtatttataattttcagcaggattgatttgtttcatcctatacagtggctgtctgat
tctttcagtgacctgtatagttcctatgtaatcttttacttcctgctgctgtcagtggta
ataataataataagtattttcaatgtggagttctatgcagtgataacccagggccagtac
agctttcttgtggttccctgcactggtactaacagctttggtagccctgctgcgcaaacc
tgcttaaatgaatatcatctttttttcctactgactggagcatttatgggctatagctat
agcctcctgtattttgttaacaacatgaactatcttccatttcccatcatacagcaatac
aagttcttgcgttttaggagatctctgctcttattagttaaacacagttgtgtggaatca
ctgttcctggttagaaatttctgcattttatattattttcttggctatattcccaaagct
tggattagcactgctatgaaccttcacatagatgagcaggttcataggccacttgacaca
gtgagtggcctcttaaatctctcgttactctaccatgtctggctgtgtggtgtctttctc
ctgacgacttggtatgtctcatggatactcttcaaaatctatgccacagaggctcatgtg
tttcctgttcaaccaccatttgcagaagggtcagatgagtgccttccaaaagtgttaaat
agcaatcctccccccatcataaagtatttagccttgcaggacctgatgttgctttctcaa
tattctccttcacgaagacaagaagttttcagcctcagccaaccaggtggacatccccac
aattggacagccatttcaagggagtgtttgaatcttttaaatggtatgactcagaaactg
attctctatcaagaagctgctgctacgaatgggagagtgtcttcatcttacccagtggaa
cctaagaaattaaattctccagaagaaactgcttttcagacaccaaaatctagccagatg
cctcggccttcagtgccaccattagttaaaacatcactgttttcttcaaaattatctaca
cctgatgttgtgagcccatttgggaccccatttggctctagtgtaatgaatcggatggct
ggaatttttgatgtaaacacctgctatgggtcaccgcaaagtcctcagctaataagaagg
gggccaagattgtggacatcagcttctgatcagcaaatgactgaattttctaatccttct
ccatctacctctattagtgctgagggtaagacaatgagacaacccagtgtgatttattca
tggattcagaataaacgtgaacagattaagaatttcttgtcaaaacgggtgctgataatg
tattttttcagtaagcacccagaggcctccattcaggctgttttttcagatgcccaaatg
catatttgggcattagaaggtctgtcgcacttagtagcagcatcatttacagaggataga
tttggagttgtccagacgacactaccagctatccttaatactttgttgacactgcaagag
gcagtcgacaagtactttaagcttcctcatgcttccagtaaaccaccccggatttcagga
agccttgtggacacttcatataaaacattaagatttgcattcagagcatcactgaaaact
gccatctatcgaataactactacatttggtgaacatctgaatgctgtgcaagcatctgca
gaacatcagaaaagacttcaacagttcttggagttcaaagaatag

DBGET integrated database retrieval system