KEGG   Homo sapiens (human): 55706Help
Entry
55706             CDS       T01001                                 

Gene name
NDC1, NET3, TMEM48
Definition
(RefSeq) NDC1 transmembrane nucleoporin
  KO
K14315  
nucleoporin NDC1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    55706 (NDC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55706 (NDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32.3
AA seq 674 aa AA seqDB search
MATAVSRPCAGRSRDILWRVLGWRIVASIVWSVLFLPICTTVFIIFSRIDLFHPIQWLSD
SFSDLYSSYVIFYFLLLSVVIIIISIFNVEFYAVVPSIPCSRLALIGKIIHPQQLMHSFI
HAAMGMVMAWCAAVITQGQYSFLVVPCTGTNSFGSPAAQTCLNEYHLFFLLTGAFMGYSY
SLLYFVNNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFLVRNFCILYYFLGYIPKA
WISTAMNLHIDEQVHRPLDTVSGLLNLSLLYHVWLCGVFLLTTWYVSWILFKIYATEAHV
FPVQPPFAEGSDECLPKVLNSNPPPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPH
NWTAISRECLNLLNGMTQKLILYQEAAATNGRVSSSYPVEPKKLNSPEETAFQTPKSSQM
PRPSVPPLVKTSLFSSKLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRR
GPRLWTSASDQQMTEFSNPSPSTSISAEGKTMRQPSVIYSWIQNKREQIKNFLSKRVLIM
YFFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQE
AVDKYFKLPHASSKPPRISGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASA
EHQKRLQQFLEFKE
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggccacggccgtgagccggccctgcgccggcaggtcgcgggacatactgtggcgcgtt
ttgggctggaggatagttgcaagtattgtttggtcagtgctatttctacccatctgcacc
acagtatttataattttcagcaggattgatttgtttcatcctatacagtggctgtctgat
tctttcagtgacctgtatagttcctatgtaatcttttacttcctgctgctgtcagtggta
ataataataataagtattttcaatgtggagttctatgcagttgtgccttctattccttgc
tccagactagctctgatagggaagatcattcatcctcagcaactcatgcactcatttatt
catgctgcaatgggaatggtgatggcctggtgtgctgcagtgataacccagggccagtac
agctttcttgtggttccctgcactggtactaacagctttggtagccctgctgcgcaaacc
tgcttaaatgaatatcatctttttttcctactgactggagcatttatgggctatagctat
agcctcctgtattttgttaacaacatgaactatcttccatttcccatcatacagcaatac
aagttcttgcgttttaggagatctctgctcttattagttaaacacagttgtgtggaatca
ctgttcctggttagaaatttctgcattttatattattttcttggctatattcccaaagct
tggattagcactgctatgaaccttcacatagatgagcaggttcataggccacttgacaca
gtgagtggcctcttaaatctctcgttactctaccatgtctggctgtgtggtgtctttctc
ctgacgacttggtatgtctcatggatactcttcaaaatctatgccacagaggctcatgtg
tttcctgttcaaccaccatttgcagaagggtcagatgagtgccttccaaaagtgttaaat
agcaatcctccccccatcataaagtatttagccttgcaggacctgatgttgctttctcaa
tattctccttcacgaagacaagaagttttcagcctcagccaaccaggtggacatccccac
aattggacagccatttcaagggagtgtttgaatcttttaaatggtatgactcagaaactg
attctctatcaagaagctgctgctacgaatgggagagtgtcttcatcttacccagtggaa
cctaagaaattaaattctccagaagaaactgcttttcagacaccaaaatctagccagatg
cctcggccttcagtgccaccattagttaaaacatcactgttttcttcaaaattatctaca
cctgatgttgtgagcccatttgggaccccatttggctctagtgtaatgaatcggatggct
ggaatttttgatgtaaacacctgctatgggtcaccgcaaagtcctcagctaataagaagg
gggccaagattgtggacatcagcttctgatcagcaaatgactgaattttctaatccttct
ccatctacctctattagtgctgagggtaagacaatgagacaacccagtgtgatttattca
tggattcagaataaacgtgaacagattaagaatttcttgtcaaaacgggtgctgataatg
tattttttcagtaagcacccagaggcctccattcaggctgttttttcagatgcccaaatg
catatttgggcattagaaggtctgtcgcacttagtagcagcatcatttacagaggataga
tttggagttgtccagacgacactaccagctatccttaatactttgttgacactgcaagag
gcagtcgacaagtactttaagcttcctcatgcttccagtaaaccaccccggatttcagga
agccttgtggacacttcatataaaacattaagatttgcattcagagcatcactgaaaact
gccatctatcgaataactactacatttggtgaacatctgaatgctgtgcaagcatctgca
gaacatcagaaaagacttcaacagttcttggagttcaaagaatag

DBGET integrated database retrieval system