KEGG   Homo sapiens (human): 55722Help
Entry
55722             CDS       T01001                                 

Gene name
CEP72
Definition
(RefSeq) centrosomal protein 72
  KO
K16532  
centrosomal protein CEP72
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     55722 (CEP72)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.33
AA seq 647 aa AA seqDB search
MARAGPRLVLSEEAVRAKSGLGPHRDLAELQSLSIPGTYQEKITHLGHSLMSLTGLKSLD
LSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDY
RLFVVHLLPKLQQLDDRPVRASERKASRLHFASEDSLDSKESVPASLKEGRPHHPRAKCT
EALAKQSLVMDADDEAVLNLIAECEWDLGRPPGSTSFSQKGREADSRGSQESRHLLSPQL
VQYQCGDSGKQGRETRRSSCRGCCLEKMPWSQLCGELPPLYGAEPEASRAPRPHTYFTPH
PDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMPVGRFQTFSDQEGLGCPERTHGS
SVPKESLSRQDSSESRNGRTLSQPEASETEEQRSRGVTDTREPSPGSHSALPGKKTALQA
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDSSAMVGEDVGSLALE
SKSLQSRLAEQQQQHAREMSEVTAELHHTHKELDDLRQHLDKSLEENSRLKSLLLSMKKE
VKSADTAATLNLQIAGLQTSVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNE
HLLQELSQVRAQHRAEVEQMHWSYQELKKTMALFPHSSASHGGCQAC
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggctggccctcggctggtgctgagcgaggaggcggttcgggcgaagagcggc
ttagggcctcaccgcgacctggctgagcttcagtcattgtctattcctggaacttaccaa
gagaagatcacccacctgggacattctctgatgagtttaacaggtctgaaatctttggat
ctctcgcgcaactccttggttagtctggagggcattcagtacctgactgcattggagagt
ctcaatctctactacaactgcatctcctcgttggcagaagtgtttcggctccacgcctta
accgagctcgtggatgtggacttccggctgaaccccgtggtgaaggttgagcctgactac
cgcctttttgttgtgcacctgctccccaagctccagcagctggacgatcgccccgtgaga
gcaagcgagcggaaggcttcccgactgcattttgcatcagaggactcactcgactccaaa
gagagcgtcccagcttctttgaaagagggcagaccacaccaccccagagccaagtgcacc
gaggccttggccaagcagagcctggtcatggatgcggatgacgaggcagtcctgaacctc
attgcagagtgcgagtgggacctcggcaggcctcccgggagcacgagcttcagccagaag
gggcgtgaggccgactctcgtggttcccaagaatccagacatctgttgagcccgcagttg
gtacagtaccagtgtggggactctgggaagcagggccgtgagacgaggaggagcagctgc
agagggtgctgtctggagaagatgccttggagccagctctgtggagagcttccgccactg
tacggagcggagccagaggcctcccgtgcccccaggccacacacgtacttcaccccacac
ccagactccatggataccgaggactcggcctcttctcagaagttggatttgtcaggagaa
atggtgcctggtcccctgccagcccccggaaagtgcaggaagcgaagaatgcctgttgga
agattccagacgttttcggaccaggagggtttgggctgcccggagagaactcatgggtcc
tccgtgcccaaggagagcctgagcagacaggacagctcagaaagcaggaacgggaggacc
ttgtctcagcctgaggcctcggagactgaggagcagaggtctcggggtgtgaccgacacc
agagagccgtctcccgggtcacactcggctctacccgggaagaagacggccctgcaggcg
gcgctcctggagacgctcttggacctggtggacaggagctggggcggctgcaggtccctg
cacagcaacgaggcattccttgctcaggcaagacacatcttgtcatctgttgaagaattc
acagcagctcaggacagctctgcgatggtgggtgaagatgtcggctccctggctctggag
agtaagtccctgcaaagccgccttgctgagcagcagcagcagcacgcccgggagatgagc
gaggtgacggcggagctgcaccacacacacaaggagctggatgatttgagacaacattta
gataaatctttggaagagaacagtaggttaaaatcgcttttgttgagtatgaaaaaggaa
gtgaagagtgcagacactgcagccacgttaaatttgcagatcgctggacttcaaacaagt
gtgaagaggctgtgtggcgagattgtggaactgaagcagcacctggagcactacgacaag
atccaggagctcacgcagatgctgcaggagagccacagctccctggtcagcaccaatgaa
cacctgctgcaggagctgagccaggtgcgggcgcagcacagagccgaggtggagcagatg
cactggagctaccaggagctcaagaagaccatggccctgtttccacacagcagcgccagc
catggaggctgccaggcctgctga

DBGET integrated database retrieval system