KEGG   Homo sapiens (human): 55740Help
Entry
55740             CDS       T01001                                 

Gene name
ENAH, ENA, MENA, NDPP1
Definition
enabled homolog (Drosophila)
Orthology
K05746  
enabled
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    55740 (ENAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.12
AA seq 591 aa AA seqDB search
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVI
NCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTL
PRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERER
LERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLER
ERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAET
PSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQV
PPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPV
TSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPL
SQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagagtatctgtcaggcaagagctgctgtgatggtttatgatgatgccaat
aagaagtgggtgccagctggtggctcaactggattcagcagagttcatatctatcaccat
acaggcaacaacacattcagagtggtgggcaggaagattcaggaccatcaggtcgtgata
aactgtgccattcctaaagggttgaagtacaatcaagctacacagaccttccaccagtgg
cgagatgctagacaggtgtatggtctcaactttggcagcaaagaggatgccaatgtcttc
gcaagtgccatgatgcatgccttagaagtgttaaattcacaggaaacagggccaacattg
cctagacaaaactcacaactacctgctcaagttcaaaatggcccatcccaagaagaattg
gaaattcaaagaagacaactacaagaacagcaacggcaaaaggagctggagcgggaaagg
ctggagcgagaaagaatggaaagagaaaggttggagagagagaggttagaaagggaaagg
ctggagagggagcgactggaacaagaacagctggagagagagagacaagaacgggaacgg
caggaacgcctggagcggcaggaacgcctggagcggcaggaacgcctggagcggcaggaa
cgcctggatcgggagaggcaagaaagacaagaacgagagaggctggagagactggaacgg
gagaggcaagaaagggagcgacaagagcagttagaaagggaacagctggaatgggagaga
gagcgcagaatatcaagtgctgctgcccctgcctctgttgagactcctctaaactctgtg
ctgggagactcttctgcttctgagccaggcttgcaggcagcctctcagccggccgagact
ccatcccaacagggcattgtcttgggaccacttgcacctccacctcctccaccactccca
ccagggcctgcacaggcttcagtagccctccctcctcccccagggccccctccacctcct
ccactcccatccaccgggcctccaccgccccctcctccccctcctctccctaatcaagta
ccccctcctcctccaccacctcctgccccacccctccctgcatctggattctttttggca
tccatgtcagaagacaatcgccctttaactggacttgcagctgcaattgccggagcaaaa
cttaggaaagtgtcacggatggaggatacctctttcccaagtggagggaatgctattggt
gtgaactccgcctcatctaaaacagatacaggccgtggaaatggaccccttcctttaggg
ggtagtggtttaatggaagaaatgagtgccctgctggccaggaggagaagaattgctgaa
aagggatcaacaatagaaacagaacaaaaagaggacaaaggtgaagattcagagcctgta
acttctaaggcctcttcaacaagtacacctgaaccaacaagaaaaccttgggaaagaaca
aatacaatgaatggcagcaagtcacctgttatctccagacgggattctccaaggaaaaat
cagattgtttttgacaacaggtcctatgattcattacacagaccaaaatccacaccctta
tcacagcccagtgccaatggagtccagacggaaggacttgactatgacaggctgaagcag
gacattttagatgaaatgagaaaagaattaacaaagctaaaagaagagctcattgatgca
atcaggcaggaactgagcaagtcaaatactgcatag

DBGET integrated database retrieval system