KEGG   Homo sapiens (human): 55742Help
Entry
55742             CDS       T01001                                 

Gene name
PARVA, CH-ILKBP, MXRA2
Definition
parvin, alpha
Orthology
K06275  
parvin
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Class
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.3
AA seq 412 aa AA seqDB search
MLGIIPLPFGKPQPQSRRRPLRPPSASSASRPARGSLRRAMATSPQKSPSVPKSPTPKSP
PSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEV
RTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQY
FRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDK
LNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSF
EQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaataattccgcttccgtttggaaagccgcagcctcagtcccgccgccgcccg
ctgcgtccgcccagcgccagctccgcgtcccgaccggcccgcggcagcctgcgccgcgcc
atggccacctccccgcagaagtcgccttctgtccccaagtctcccactcccaagtcgccc
ccgtcccgcaagaaagatgattccttcttggggaaactcggagggaccctggcccggagg
aagaaagccaaggaggtgtccgagctgcaggaggagggaatgaacgccatcaacctgccc
ctcagcccaattccctttgagctggaccccgaggacacgatgctggaggagaatgaggtg
cgaacaatggtggatccaaactcacgcagtgaccccaagcttcaagaactgatgaaggta
ttaattgactggattaatgatgtgttggttggagaaagaatcattgtgaaagacctagct
gaagatttgtatgatggacaagtcctgcagaagcttttcgagaaactggagagtgagaag
ctaaatgtggctgaggtcacccagtcagagattgctcagaagcaaaaactgcagactgtc
ctggagaagatcaatgaaaccctgaaacttcctcccaggagcatcaagtggaatgtggat
tctgttcatgccaagagcctggtggccatcttacacctgctcgttgctctgtctcagtat
ttccgcgcaccaattcgactcccagaccatgtttccatccaagtggttgtggtccagaaa
cgagaaggaatcctccagtctcggcaaatccaagaggaaataactggtaacacagaggct
ctttccgggaggcatgaacgtgatgcctttgacaccttgttcgaccatgccccagacaag
ctgaatgtggtgaaaaagacactcatcactttcgtgaacaagcacctgaataaactgaac
ctggaggtcacagaactggaaacccagtttgcagatggggtgtacctggtgctgctcatg
gggctcctggagggctactttgtgcccctgcacagcttcttcctgaccccggacagcttt
gaacagaaggtcttgaatgtctcctttgcctttgagctcatgcaagatggagggttggaa
aagccaaaaccgcggccagaagacatagtcaactgtgacctgaaatctacactacgagtg
ttgtacaacctcttcaccaagtaccgtaacgtggagtga

DBGET integrated database retrieval system