KEGG   Homo sapiens (human): 55746Help
Entry
55746             CDS       T01001                                 

Gene name
NUP133, hNUP133
Definition
(RefSeq) nucleoporin 133
  KO
K14300  
nuclear pore complex protein Nup133
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    55746 (NUP133)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55746 (NUP133)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    55746 (NUP133)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.13
AA seq 1156 aa AA seqDB search
MFPAAPSPRTPGTGSRRGPLAGLGPGSTPRTASRKGLPLGSAVSSPVLFSPVGRRSSLSS
RGTPTRMFPHHSITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCK
EKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATR
EGSIRYWPSLAGEDTYTEAFVDSGGDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKI
HQHILPQGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWDRERSSFYSLTSSNISKWELD
DSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWH
SADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLY
NESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRENVS
ILAEDLEGSLASSVAGPNSESMIFETTTKNETIAQEDKIKLLKAAFLQYCRKDLGHAQMV
VDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQ
LEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEKLSAAIVLKNHHSRL
SDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEHEEQVLRDAPMDSIE
WAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSGPGGIRTVIIR
QHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYL
QKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDF
LFRWYLEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANME
TRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNL
SAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDEEEDININDLKLEILCKALQR
DNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYF
EFVLKANYEYYVQGQI
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atgttcccagccgccccttctccgcggaccccgggtaccgggtcccgaaggggcccgctg
gccggactcgggcccggctccacgccccggacggctagcaggaagggtctgcccctgggg
tctgcagtcagctccccagtgctcttctcgccggtcggccggcgtagctcgctaagctcg
cggggaacaccaacacgaatgttcccacaccactccataactgagtctgtgaactatgat
gtgaaaacgtttggatcttctcttcctgttaaagtcatggaagccctaacattggctgaa
gtcgatgaccagctgaccattaacatagatgaaggtggatgggcttgtctggtgtgcaaa
gagaagctcattatttggaagattgctctgtcacctattactaagttatccgtttgcaaa
gaacttcagctgccacctagtgatttccactggagtgccgacttagtggctctttcttac
tcttctccctcaggtgaagcacattctactcaggctgttgctgtcatggttgccaccaga
gaaggatctatccgctattggccaagccttgctggtgaagatacctacacagaggctttt
gtagattcgggaggtgataagacttacagtttcctaacagcagtgcagggaggaagtttt
attttgtcttcatcaggaagccaactaattcggttgatacctgagagctcaggaaagatt
catcagcatatcctgcctcaggggcaaggcatgctttcaggaattggtcgaaaagtttct
tctctttttggaattttatctcctagtagtgatctcacactttcaagtgttctctgggat
agagagagatcaagcttttatagcctgacgagttcaaacatcagtaaatgggaattagat
gattcttcagaaaagcatgcatacagttgggatataaatagagccctgaaggaaaacatt
accgatgctatttggggatctgaaagtaactatgaagctattaaagaaggagtcaacatt
cgatatttggacttgaagcaaaactgtgatgggctggtgattttggcagcagcatggcac
tcagcagacaatccatgtctcatctattactctctgataacaatagaagataatggttgc
caaatgtcagatgcagttactgtagaagtcactcaatataatccaccttttcagtctgaa
gacctgattttgtgtcagttgacggtcccaaacttttcaaaccagactgcctatctgtat
aacgaaagtgctgtctatgtgtgctccacaggaactgggaaattttctcttccccaggag
aaaattgtctttaatgcacaaggagatagtgttttaggtgctggtgcctgtggtggtgtt
cctatcattttttctagaaacagtggactggtgtctattacttcaagggaaaatgtgtct
atattggcagaagacttggaagggtctttagcatcttcagttgctggaccaaacagtgag
agtatgatttttgagaccactacaaagaatgaaactatagcccaggaagataaaatcaag
ttgctgaaagctgcctttctgcaatactgcagaaaagatttaggtcatgctcaaatggtg
gttgatgagctcttttcctctcactctgatttggattctgattctgaactagacagggca
gttacccaaatcagtgtagacctgatggatgactacccagcatctgacccacggtgggct
gagtctgtccctgaggaagcacctgggttcagcaatacgtcactgattatccttcaccag
ctagaagacaagatgaaagctcactcttttcttatggactttattcatcaagttggctta
tttggacgtctaggcagttttccagttagagggacaccgatggccactcgactgttgctc
tgtgagcatgccgaaaagctgtcagccgccattgttctcaagaaccaccactcccggctt
tctgaccttgtcaacacagccatattgattgctttgaacaagagggagtatgaaatccca
tccaacctgactcctgcagatgtctttttcagggaggtatcccaagtagataccatctgt
gagtgcttactggagcatgaggagcaagtcttgagggatgcacctatggattccattgaa
tgggctgaagtggtgatcaatgtgaacaatattctcaaggatatgctgcaggctgctagt
cattatcgccaaaatagaaactctttgtatagaagagaagaatcactagaaaaagaacct
gaatatgttccatggacggcaacaagtggtcctggtggcatccgaacggtaataatacgc
cagcatgagattgtcctgaaggtggcttatccacaggcagacagcaacctccgaaacatc
gtgaccgagcagctggtagccctgatcgattgcttcctggatggttatgtttctcagctt
aagtctgtggataaatccagtaatcgggaaagatatgacaatctggagatggaataccta
cagaaaagatcagatctcttatctcctcttctttcactaggccagtacctgtgggctgct
tctctagcagagaaatactgtgactttgatatattggtacaaatgtgtgagcagactgac
aaccagagccgactccagcgctacatgacccagtttgctgatcagaatttttcagacttt
ctcttccgttggtatctggagaaaggaaagcgaggcaaattattatctcagcccatttct
cagcatggacagttggcaaattttttgcaagctcatgaacatctcagctggttacatgaa
attaatagccaagaattagaaaaggctcatgcaacacttctgggtttggcaaatatggaa
actcgttactttgcaaagaagaaaacccttcttggcttgagtaaattggctgcattagct
tcagacttttcagaggatatgctacaagaaaaaattgaagaaatggctgagcaggagcgc
tttctactgcatcaggagaccctacctgaacagctgctggcggagaaacagctaaatctc
agtgcgatgccagtattgactgcaccacaactcattggtctatatatctgtgaagaaaat
agaagagctaatgaatatgatttcaagaaagctttggacttgttggaatatattgatgag
gaagaagatataaatataaatgatctaaaactggaaatcctttgcaaagctcttcagaga
gataactggtccagttctgatggcaaagatgatccaattgaagtatctaaagacagtata
tttgtgaagatcttacagaaacttttaaaagatggcattcagctcagtgagtacttaccg
gaggtgaaagacctgctacaagcggatcagcttggaagcttaaagtccaatccttacttc
gagtttgttttgaaagcaaattatgaatattatgttcagggacaaatataa

DBGET integrated database retrieval system