KEGG   Homo sapiens (human): 55750Help
Entry
55750             CDS       T01001                                 

Gene name
AGK, CATC5, CTRCT38, MTDPS10, MULK
Definition
acylglycerol kinase (EC:2.7.1.107 2.7.1.94)
Orthology
K09881  
acylglycerol kinase [EC:2.7.1.94]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    55750 (AGK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.94  acylglycerol kinase
     55750 (AGK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
7q34
AA seq 422 aa AA seqDB search
MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQV
KKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVII
VAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATL
AIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFST
LKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSP
EVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHV
EGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSP
TQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgttctttaaaacgcttcgaaatcactggaagaaaactacagctgggctctgc
ctgctgacctggggaggccattggctctatggaaaacactgtgataacctcctaaggaga
gcagcctgtcaagaagctcaggtgtttggcaatcaactcattcctcccaatgcacaagtg
aagaaggccactgtttttctcaatcctgcagcttgcaaaggaaaagccaggactctattt
gaaaaaaatgctgccccgattttacatttatctggcatggatgtgactattgttaagaca
gattatgagggacaagccaagaaactcctggaactgatggaaaacacggatgtgatcatt
gttgcaggaggagatgggacactgcaggaggttgttactggtgttcttcgacgaacagat
gaggctaccttcagtaagattcccattggatttatcccactgggagagaccagtagtttg
agtcataccctctttgccgaaagtggaaacaaagtccaacatattactgatgccacactt
gccattgtgaaaggagagacagttccacttgatgtcttgcagatcaagggtgaaaaggaa
cagcctgtatttgcaatgaccggccttcgatggggatctttcagagatgctggcgtcaaa
gttagcaagtactggtatcttgggcctctaaaaatcaaagcagcccactttttcagcact
cttaaggagtggcctcagactcatcaagcctctatctcatacacgggacctacagagaga
cctcccaatgaaccagaggagacccctgtacaaaggccttctttgtacaggagaatatta
cgaaggcttgcgtcctactgggcacaaccacaggatgccctttcccaagaggtgagcccg
gaggtctggaaagatgtgcagctgtccaccattgaactgtccatcacaacacggaataat
cagcttgacccgacaagcaaagaagattttctgaatatctgcattgaacctgacaccatc
agcaaaggagactttataactataggaagtcgaaaggtgagaaaccccaagctgcacgtg
gagggcacggagtgtctccaagccagccagtgcactttgcttatcccggagggagcaggg
ggctcttttagcattgacagtgaggagtatgaagcgatgcctgtggaggtgaaactgctc
cccaggaagctgcagttcttctgtgatcctaggaagagagaacagatgctcacaagcccc
acccagtga

DBGET integrated database retrieval system