KEGG   Homo sapiens (human): 55766Help
Entry
55766             CDS       T01001                                 

Gene name
H2AFJ, H2AJ
Definition
H2A histone family, member J
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    55766 (H2AFJ)
  Substance dependence
   05034 Alcoholism
    55766 (H2AFJ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55766 (H2AFJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
12p12.3
AA seq 129 aa AA seqDB search
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESQKTKSK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtcgcgggaaacagggcggcaaagtgcgagcaaaggccaaatcccgctcctcc
cgcgcgggcctgcagttcccggtgggccgagtgcacagactgctgcgcaaagggaactac
gcggagcgagtgggcgccggggcgccggtgtacctggcggcggtgttggagtaccttacg
gcggagatcctggagctggctggcaacgccgcgcgtgacaacaagaagaccaggataatt
ccccgccacctgcagctcgccatccgcaacgacgaggagttaaacaagctgctgggcaaa
gtgaccatcgctcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
acggagagtcagaagacgaagagcaaatga

DBGET integrated database retrieval system