KEGG   Homo sapiens (human): 55775Help
Entry
55775             CDS       T01001                                 

Gene name
TDP1
Definition
(RefSeq) tyrosyl-DNA phosphodiesterase 1
  KO
K10862  
tyrosyl-DNA phosphodiesterase 1 [EC:3.1.4.-]
Organism
hsa  Homo sapiens (human)
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     55775 (TDP1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     55775 (TDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.11
AA seq 608 aa AA seqDB search
MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKI
SPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPN
DGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNS
GALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHA
QAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSP
LYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPG
RFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM
LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKW
SAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELG
VLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDT
HGNMWVPS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggaaggcgattatgggaggtggaccatatctagtagtgatgaaagtgaggaa
gaaaagccaaaaccagacaagccatctacctcttctcttctctgtgccaggcaaggagca
gcaaatgagcccaggtacacctgttccgaggcccagaaagctgcacacaagaggaaaata
tcacctgtgaaattcagcaatacagattcagttttacctcccaaaaggcagaaaagcggt
tcccaggaggacctcggctggtgtctgtccagcagtgatgatgagctgcaaccagaaatg
ccgcagaagcaggctgagaaagtggtgatcaaaaaggagaaagacatctctgctcccaat
gacggcactgcccaaagaactgaaaatcatggcgctcccgcctgccacaggctcaaagag
gaggaagacgagtatgagacatcaggggagggccaggacatttgggacatgctggataaa
gggaaccccttccagttttacctcactagagtctctggagttaagccaaagtataactct
ggagccctccacatcaaggatattttatctcctttatttgggacgcttgtttcttcagct
cagtttaactactgctttgacgtggactggctcgtaaaacagtatccaccagagttcagg
aagaagccaatcctgcttgtgcatggtgataagcgagaggctaaggctcacctccatgcc
caggccaagccttacgagaacatctctctctgccaggcaaagttggatattgcgtttgga
acacaccacacgaaaatgatgctgctgctctatgaagaaggcctccgggttgtcatacac
acctccaacctcatccatgctgactggcaccagaaaactcaaggaatatggttgagcccc
ttatacccacgaattgctgatggaacccacaaatctggagagtcgccaacacattttaaa
gctgatctcatcagttacttgatggcttataatgccccttctctcaaggagtggatagat
gtcattcacaagcacgatctctctgaaacaaatgtttatcttattggttcaaccccagga
cgctttcaaggaagtcaaaaagataattggggacattttagacttaagaagcttctgaaa
gaccatgcctcatccatgcctaacgcagagtcctggcctgtcgtaggtcagttttcaagc
gttggctccttgggagccgatgaatcaaagtggttatgttctgagtttaaagagagcatg
ctgacactggggaaggaaagcaagactccaggaaaaagctctgttcctctttacttgatc
tatccttctgtggaaaatgtgcggaccagtttagaaggatatcctgctgggggctctctt
ccctatagcatccagacagctgaaaaacagaattggctgcattcctattttcacaaatgg
tcagctgagacttctggccgcagcaatgccatgccacatattaagacatatatgaggcct
tctccagacttcagtaaaattgcttggttccttgtcacaagcgcaaatctgtccaaggct
gcctggggagcattggagaagaatggcacccagctgatgatccgctcctacgagctcggg
gtccttttcctcccttcagcatttggtctagacagtttcaaagtgaaacagaagttcttc
gctggcagccaggagccaatggccacctttcctgtgccatatgatttgcctccagaactg
tatggaagtaaagatcggccatggatatggaacattccttatgtcaaagcaccggatacg
catgggaacatgtgggtgccctcctga

DBGET integrated database retrieval system