KEGG   Homo sapiens (human): 5578Help
Entry
5578              CDS       T01001                                 

Gene name
PRKCA, AAG6, PKC-alpha, PKCA, PRKACA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  
classical protein kinase C alpha type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Gap junction
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Aldosterone synthesis and secretion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Amphetamine addiction
Morphine addiction
Vibrio cholerae infection
Pathogenic Escherichia coli infection
African trypanosomiasis
Amoebiasis
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Hepatocellular carcinoma
Choline metabolism in cancer
Network
N00023  
EGF-EGFR-PLCG-ERK signaling pathway
N00024  
Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  
EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  
TGFA-EGFR-PLCG-PKC signaling pathway
N00228  
TGFA-overexpression to PLCG-PKC signaling pathway
Drug target
Midostaurin: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5578 (PRKCA)
   04015 Rap1 signaling pathway
    5578 (PRKCA)
   04010 MAPK signaling pathway
    5578 (PRKCA)
   04012 ErbB signaling pathway
    5578 (PRKCA)
   04310 Wnt signaling pathway
    5578 (PRKCA)
   04370 VEGF signaling pathway
    5578 (PRKCA)
   04066 HIF-1 signaling pathway
    5578 (PRKCA)
   04020 Calcium signaling pathway
    5578 (PRKCA)
   04070 Phosphatidylinositol signaling system
    5578 (PRKCA)
   04072 Phospholipase D signaling pathway
    5578 (PRKCA)
   04071 Sphingolipid signaling pathway
    5578 (PRKCA)
   04151 PI3K-Akt signaling pathway
    5578 (PRKCA)
   04150 mTOR signaling pathway
    5578 (PRKCA)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5578 (PRKCA)
   04540 Gap junction
    5578 (PRKCA)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5578 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    5578 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    5578 (PRKCA)
   04670 Leukocyte transendothelial migration
    5578 (PRKCA)
  Endocrine system
   04911 Insulin secretion
    5578 (PRKCA)
   04912 GnRH signaling pathway
    5578 (PRKCA)
   04921 Oxytocin signaling pathway
    5578 (PRKCA)
   04926 Relaxin signaling pathway
    5578 (PRKCA)
   04918 Thyroid hormone synthesis
    5578 (PRKCA)
   04919 Thyroid hormone signaling pathway
    5578 (PRKCA)
   04916 Melanogenesis
    5578 (PRKCA)
   04925 Aldosterone synthesis and secretion
    5578 (PRKCA)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5578 (PRKCA)
   04270 Vascular smooth muscle contraction
    5578 (PRKCA)
  Digestive system
   04970 Salivary secretion
    5578 (PRKCA)
   04971 Gastric acid secretion
    5578 (PRKCA)
   04972 Pancreatic secretion
    5578 (PRKCA)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5578 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5578 (PRKCA)
  Nervous system
   04724 Glutamatergic synapse
    5578 (PRKCA)
   04727 GABAergic synapse
    5578 (PRKCA)
   04725 Cholinergic synapse
    5578 (PRKCA)
   04728 Dopaminergic synapse
    5578 (PRKCA)
   04726 Serotonergic synapse
    5578 (PRKCA)
   04720 Long-term potentiation
    5578 (PRKCA)
   04730 Long-term depression
    5578 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    5578 (PRKCA)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5578 (PRKCA)
  Development
   04360 Axon guidance
    5578 (PRKCA)
  Environmental adaptation
   04713 Circadian entrainment
    5578 (PRKCA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5578 (PRKCA)
   05231 Choline metabolism in cancer
    5578 (PRKCA)
   05206 MicroRNAs in cancer
    5578 (PRKCA)
   05205 Proteoglycans in cancer
    5578 (PRKCA)
   05225 Hepatocellular carcinoma
    5578 (PRKCA)
   05214 Glioma
    5578 (PRKCA)
   05223 Non-small cell lung cancer
    5578 (PRKCA)
  Substance dependence
   05031 Amphetamine addiction
    5578 (PRKCA)
   05032 Morphine addiction
    5578 (PRKCA)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5578 (PRKCA)
  Infectious diseases
   05110 Vibrio cholerae infection
    5578 (PRKCA)
   05130 Pathogenic Escherichia coli infection
    5578 (PRKCA)
   05164 Influenza A
    5578 (PRKCA)
   05161 Hepatitis B
    5578 (PRKCA)
   05146 Amoebiasis
    5578 (PRKCA)
   05143 African trypanosomiasis
    5578 (PRKCA)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5578 (PRKCA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5578 (PRKCA)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5578 (PRKCA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    5578 (PRKCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P17252(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17q24.2
AA seq 672 aa AA seqDB search
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccgcagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaacgtacccattccggaaggggacgaggaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagagcatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgtggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccacct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

KEGG   Homo sapiens (human): 5579Help
Entry
5579              CDS       T01001                                 

Gene name
PRKCB, PKC-beta, PKCB, PRKCB1, PRKCB2
Definition
(RefSeq) protein kinase C beta
  KO
K19662  
classical protein kinase C beta type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
mTOR signaling pathway
Vascular smooth muscle contraction
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Gap junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Aldosterone synthesis and secretion
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Amphetamine addiction
Morphine addiction
Leishmaniasis
African trypanosomiasis
Amoebiasis
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Hepatocellular carcinoma
Choline metabolism in cancer
Network
N00023  
EGF-EGFR-PLCG-ERK signaling pathway
N00024  
Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  
EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  
TGFA-EGFR-PLCG-PKC signaling pathway
N00228  
TGFA-overexpression to PLCG-PKC signaling pathway
Drug target
Enzastaurin hydrochloride: 
Safingol: 
Safingol hydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5579 (PRKCB)
   04015 Rap1 signaling pathway
    5579 (PRKCB)
   04010 MAPK signaling pathway
    5579 (PRKCB)
   04012 ErbB signaling pathway
    5579 (PRKCB)
   04310 Wnt signaling pathway
    5579 (PRKCB)
   04370 VEGF signaling pathway
    5579 (PRKCB)
   04064 NF-kappa B signaling pathway
    5579 (PRKCB)
   04066 HIF-1 signaling pathway
    5579 (PRKCB)
   04020 Calcium signaling pathway
    5579 (PRKCB)
   04070 Phosphatidylinositol signaling system
    5579 (PRKCB)
   04071 Sphingolipid signaling pathway
    5579 (PRKCB)
   04150 mTOR signaling pathway
    5579 (PRKCB)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5579 (PRKCB)
   04540 Gap junction
    5579 (PRKCB)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5579 (PRKCB)
   04662 B cell receptor signaling pathway
    5579 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    5579 (PRKCB)
   04670 Leukocyte transendothelial migration
    5579 (PRKCB)
   04062 Chemokine signaling pathway
    5579 (PRKCB)
  Endocrine system
   04911 Insulin secretion
    5579 (PRKCB)
   04912 GnRH signaling pathway
    5579 (PRKCB)
   04921 Oxytocin signaling pathway
    5579 (PRKCB)
   04918 Thyroid hormone synthesis
    5579 (PRKCB)
   04919 Thyroid hormone signaling pathway
    5579 (PRKCB)
   04916 Melanogenesis
    5579 (PRKCB)
   04925 Aldosterone synthesis and secretion
    5579 (PRKCB)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5579 (PRKCB)
  Digestive system
   04970 Salivary secretion
    5579 (PRKCB)
   04971 Gastric acid secretion
    5579 (PRKCB)
   04972 Pancreatic secretion
    5579 (PRKCB)
   04973 Carbohydrate digestion and absorption
    5579 (PRKCB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5579 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5579 (PRKCB)
  Nervous system
   04724 Glutamatergic synapse
    5579 (PRKCB)
   04727 GABAergic synapse
    5579 (PRKCB)
   04725 Cholinergic synapse
    5579 (PRKCB)
   04728 Dopaminergic synapse
    5579 (PRKCB)
   04726 Serotonergic synapse
    5579 (PRKCB)
   04720 Long-term potentiation
    5579 (PRKCB)
   04730 Long-term depression
    5579 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    5579 (PRKCB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5579 (PRKCB)
  Environmental adaptation
   04713 Circadian entrainment
    5579 (PRKCB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5579 (PRKCB)
   05231 Choline metabolism in cancer
    5579 (PRKCB)
   05206 MicroRNAs in cancer
    5579 (PRKCB)
   05205 Proteoglycans in cancer
    5579 (PRKCB)
   05225 Hepatocellular carcinoma
    5579 (PRKCB)
   05214 Glioma
    5579 (PRKCB)
   05223 Non-small cell lung cancer
    5579 (PRKCB)
  Substance dependence
   05031 Amphetamine addiction
    5579 (PRKCB)
   05032 Morphine addiction
    5579 (PRKCB)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5579 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5579 (PRKCB)
  Infectious diseases
   05164 Influenza A
    5579 (PRKCB)
   05161 Hepatitis B
    5579 (PRKCB)
   05146 Amoebiasis
    5579 (PRKCB)
   05140 Leishmaniasis
    5579 (PRKCB)
   05143 African trypanosomiasis
    5579 (PRKCB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5579 (PRKCB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5579 (PRKCB)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5579 (PRKCB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P05771(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
16p12.2-p12.1
AA seq 671 aa AA seqDB search
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcatgaggtcaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctccgatgacccccgcagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaatgtgcac
aagcgctgcgtgatgaatgttcccagcctgtgtggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgacagggacgtcctcattgtcctcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcctgtcagatccctacgtaaaactgaaactg
attcccgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaac
cctgagtggaatgagacatttagatttcagctgaaagaatcggacaaagacagaagactg
tcagtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaacttcagaaagccagtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgcctgtgccaccagaaggaagtgaggccaatgaagaa
ctgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtcccggaagaaaag
acgaccaacactgtctccaaatttgacaacaatggcaacagagaccggatgaaactgacc
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctttcagaa
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggacgttgtgatccaa
gatgatgacgtggagtgcactatggtggagaagcgggtgttggccctgcctgggaagccg
cccttcctgacccagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaatgggggcgacctcatgtatcacatccagcaagtcggccggttcaaggag
ccccatgctgtattttacgctgcagaaattgccatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattctgagggacacatc
aagattgccgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccaatccatcatggaacacaacgtagcctat
cccaagtctatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaaacgtctgggttgtggacctgaaggcgaacgtgatatcaaagagcatgcatttttc
cggtatattgattgggagaaacttgaacgcaaagagatccagcccccttataagccaaaa
gctagagacaagagagacacctccaacttcgacaaagagttcaccagacagcctgtggaa
ctgacccccactgataaactcttcatcatgaacttggaccaaaatgaatttgctggcttc
tcttatactaacccagagtttgtcattaatgtgtag

KEGG   Homo sapiens (human): 5582Help
Entry
5582              CDS       T01001                                 

Gene name
PRKCG, PKC-gamma, PKCC, PKCG, SCA14
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  
classical protein kinase C gamma type [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
mTOR signaling pathway
Vascular smooth muscle contraction
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Gap junction
Natural killer cell mediated cytotoxicity
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Aldosterone synthesis and secretion
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Amphetamine addiction
Morphine addiction
African trypanosomiasis
Amoebiasis
Hepatitis B
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Hepatocellular carcinoma
Choline metabolism in cancer
Network
N00023  
EGF-EGFR-PLCG-ERK signaling pathway
N00024  
Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  
EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00227  
TGFA-EGFR-PLCG-PKC signaling pathway
N00228  
TGFA-overexpression to PLCG-PKC signaling pathway
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5582 (PRKCG)
   04015 Rap1 signaling pathway
    5582 (PRKCG)
   04010 MAPK signaling pathway
    5582 (PRKCG)
   04012 ErbB signaling pathway
    5582 (PRKCG)
   04310 Wnt signaling pathway
    5582 (PRKCG)
   04370 VEGF signaling pathway
    5582 (PRKCG)
   04066 HIF-1 signaling pathway
    5582 (PRKCG)
   04020 Calcium signaling pathway
    5582 (PRKCG)
   04070 Phosphatidylinositol signaling system
    5582 (PRKCG)
   04071 Sphingolipid signaling pathway
    5582 (PRKCG)
   04150 mTOR signaling pathway
    5582 (PRKCG)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    5582 (PRKCG)
   04540 Gap junction
    5582 (PRKCG)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5582 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    5582 (PRKCG)
   04670 Leukocyte transendothelial migration
    5582 (PRKCG)
  Endocrine system
   04911 Insulin secretion
    5582 (PRKCG)
   04921 Oxytocin signaling pathway
    5582 (PRKCG)
   04918 Thyroid hormone synthesis
    5582 (PRKCG)
   04919 Thyroid hormone signaling pathway
    5582 (PRKCG)
   04916 Melanogenesis
    5582 (PRKCG)
   04925 Aldosterone synthesis and secretion
    5582 (PRKCG)
  Circulatory system
   04270 Vascular smooth muscle contraction
    5582 (PRKCG)
  Digestive system
   04970 Salivary secretion
    5582 (PRKCG)
   04971 Gastric acid secretion
    5582 (PRKCG)
   04972 Pancreatic secretion
    5582 (PRKCG)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    5582 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    5582 (PRKCG)
  Nervous system
   04724 Glutamatergic synapse
    5582 (PRKCG)
   04727 GABAergic synapse
    5582 (PRKCG)
   04725 Cholinergic synapse
    5582 (PRKCG)
   04728 Dopaminergic synapse
    5582 (PRKCG)
   04726 Serotonergic synapse
    5582 (PRKCG)
   04720 Long-term potentiation
    5582 (PRKCG)
   04730 Long-term depression
    5582 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    5582 (PRKCG)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5582 (PRKCG)
  Environmental adaptation
   04713 Circadian entrainment
    5582 (PRKCG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5582 (PRKCG)
   05231 Choline metabolism in cancer
    5582 (PRKCG)
   05206 MicroRNAs in cancer
    5582 (PRKCG)
   05205 Proteoglycans in cancer
    5582 (PRKCG)
   05225 Hepatocellular carcinoma
    5582 (PRKCG)
   05214 Glioma
    5582 (PRKCG)
   05223 Non-small cell lung cancer
    5582 (PRKCG)
  Substance dependence
   05031 Amphetamine addiction
    5582 (PRKCG)
   05032 Morphine addiction
    5582 (PRKCG)
  Infectious diseases
   05161 Hepatitis B
    5582 (PRKCG)
   05146 Amoebiasis
    5582 (PRKCG)
   05143 African trypanosomiasis
    5582 (PRKCG)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    5582 (PRKCG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5582 (PRKCG)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   5582 (PRKCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P05129(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 697 aa AA seqDB search
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctgggccccggcgtaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggccctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaaa
cacaagttccgcctgcatagctacagcagccccaccttctgcgaccactgtggctccctc
ctctacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcgggcgc
ctgcagctggagatccgggctcccacagcagatgagatccacgtaactgttggcgaggcc
cgtaacctaattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagacccgaacggtgaaagccacgctaaac
cctgtgtggaatgagacctttgtgttcaacctgaagccaggggatgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggggccatgtcc
tttggcgtctcggagctgctcaaggcgcccgtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccctccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gcgagtccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctctgatgagctctacgccatcaag
atcttgaaaaaggacgtgatcgtccaggacgacgatgtggactgcacgctggtggagaaa
cgtgtgctggcgctggggggccggggtcctggcggccggccccacttcctcacccagctc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtacgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcggcagaaatcgctatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgactttggc
atgtgtaaggagaacgtcttccccgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgag
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggag
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttc
gtgcacccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system