KEGG   Homo sapiens (human): 55781Help
Entry
55781             CDS       T01001                                 

Gene name
RIOK2, RIO2
Definition
(RefSeq) RIO kinase 2 (EC:2.7.11.1)
  KO
K07179  
RIO kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    55781 (RIOK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     55781 (RIOK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  RIO family [OT]
   55781 (RIOK2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-40S particles
   Kinases
    55781 (RIOK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q15
AA seq 552 aa AA seqDB search
MGKVNVAKLRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHK
LIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGNQMGVGKESDIYIVANEEGQQF
ALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPID
YNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGDFNEFNLILDESD
HITMIDFPQMVSTSHPNAEWYFDRDVKCIKDFFMKRFSYESELFPTFKDIRREDTLDVEV
SASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYGSENESERNCLE
ESEGCYCRSSGDPEQIKEDSLSEESADARSFEMTEFNQALEEIKGQVVENNSVTEFSEEK
NRTENYNRQDGQRVQGGVPAGSDEYEDECPHLIALSSLNREFRPFRDEENVGAMNQYRTR
TLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNI
KSSLEAASFWGE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagtgaatgtggccaagttgcgttacatgagccgagatgacttcagggtcttg
accgcggttgaaatgggcatgaagaaccatgaaattgttcccggcagtttgattgcttct
atagccagccttaaacatggtggctgtaataaagttttaagagaattagtgaaacataaa
ctcatagcttgggagcgtaccaaaactgtccagggctatcggttgacaaatgcaggatat
gattacctagctttgaaaacactttcttctaggcaagtagttgagtctgttggaaaccag
atgggtgttggcaaagaatcagatatttacattgttgcaaatgaagaaggacaacaattt
gcattaaagcttcacagactaggaagaacctcgtttcgaaatttgaaaaacaaacgcgat
tatcataaacataggcacaatgtgtcatggctatatttatctcgtctctctgccatgaag
gaatttgcctatatgaaggcattgtatgagaggaaatttccagttccaaagccaattgat
tacaatcgtcatgcagtggtcatggaactcataaatggttatccactatgtcagatacac
catgttgaagatcctgcatcagtatatgatgaagctatggaactaattgtcaaacttgca
aatcatgggctgattcatggagattttaatgaatttaatctcattttggatgaaagtgac
catatcaccatgattgattttccacagatggtttcaacttctcatcccaatgctgagtgg
tattttgacagagatgttaaatgcattaaagatttctttatgaaacgtttcagctacgaa
agtgagctttttccaacttttaaggatatcaggagagaagacactcttgatgtggaggtt
tctgccagtggctacacaaaggaaatgcaggcagatgatgaactgcttcatccattaggt
ccagatgataaaaatattgaaacaaaagagggatctgaattctcattttcagatggagaa
gtggcagaaaaagcagaggtttacgggtcagaaaatgaaagtgaacggaactgtctagaa
gaatcagagggctgctattgcagatcatctggagaccctgaacaaataaaggaagacagt
ttatcagaagagagtgctgatgcacggagttttgaaatgactgaattcaatcaagcttta
gaagaaataaaagggcaggttgttgaaaacaactctgtaactgaattttctgaggagaaa
aacagaactgaaaattacaacaggcaagatggtcagagagttcaaggaggagtccctgct
ggctctgacgagtatgaagatgaatgccctcatctaattgccttgtcgtcattaaataga
gaattcaggcctttcagagatgaagaaaatgtgggagctatgaatcagtatagaacaaga
actctgagtatcacttcttcaggcagtgctgtaagctgttcaacaattcctccagaactg
gtgaaacagaaggtgaaacgtcagttgacaaaacagcaaaaatcagctgtcagacgtcga
ttgcagaaaggagaagcaaatatatttaccaagcaacgtagggaaaacatgcaaaatatc
aaatcaagtttggaagcagccagcttttggggagaataa

DBGET integrated database retrieval system