KEGG   Homo sapiens (human): 55788Help
Entry
55788             CDS       T01001                                 

Gene name
LMBRD1, C6orf209, LMBD1, MAHCF, NESI
Definition
LMBR1 domain containing 1
Orthology
K14617  
LMBR1 domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Disease
H00174  
Methylmalonic aciduria (MMA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    55788 (LMBRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q13
AA seq 540 aa AA seqDB search
MATSGAASAELVIGWCIFGLLLLAILAFCWIYVRKYQSRRESEVVSTITAIFSLAIALIT
SALLPVDIFLVSYMKNQNGTFKDWANANVSRQIEDTVLYGYYTLYSVILFCVFFWIPFVY
FYYEEKDDDDTSKCTQIKTALKYTLGFVVICALLLLVGAFVPLNVPNNKNSTEWEKVKSL
FEELGSSHGLAALSFSISSLTLIGMLAAITYTAYGMSALPLNLIKGTRSAAYERLENTED
IEEVEQHIQTIKSKSKDGRPLPARDKRALKQFEERLRTLKKRERHLEFIENSWWTKFCGA
LRPLKIVWGIFFILVALLFVISLFLSNLDKALHSAGIDSGFIIFGANLSNPLNMLLPLLQ
TVFPLDYILITIIIMYFIFTSMAGIRNIGIWFFWIRLYKIRRGRTRPQALLFLCMILLLI
VLHTSYMIYSLAPQYVMYGSQNYLIETNITSDNHKGNSTLSVPKRCDADAPEDQCTVTRT
YLFLHKFWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDISDDEPSVYSA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttctggcgcggcctcggcggagctggtgatcggctggtgcatattcggcctc
ttactactggctattttggcattctgctggatatatgttcgtaaataccaaagtcggcgg
gaaagtgaagttgtctccaccataacagcaattttttctctagcaattgcacttatcaca
tcagcacttctaccagtggatatatttttggtttcttacatgaaaaatcaaaatggtaca
tttaaggactgggctaatgctaatgtcagcagacagattgaggacactgtattatacggt
tactatactttatattctgttatattgttctgtgtgttcttctggatcccttttgtctac
ttctattatgaagaaaaggatgatgatgatactagtaaatgtactcaaattaaaacggca
ctcaagtatactttgggatttgttgtgatttgtgcactgcttcttttagttggtgccttt
gttccattgaatgttcccaataacaaaaattctacagagtgggaaaaagtgaagtcccta
tttgaagaacttggaagtagtcatggtttagctgcattgtcattttctatcagttctctg
accttgattggaatgttggcagctataacttacacagcctatggcatgtctgcgttacct
ttaaatctgataaaaggcactagaagcgctgcttatgaacgtttggaaaacactgaagac
attgaagaagtagaacaacacattcaaacgattaaatcaaaaagcaaagatggtcgacct
ttgccagcaagggataaacgcgccttaaaacaatttgaagaaaggttacgaacacttaag
aagagagagaggcatttagaattcattgaaaacagctggtggacaaaattttgtggcgct
ctgcgtcccctgaagatcgtctggggaatatttttcatcttagttgcattgctgtttgta
atttctctcttcttgtcaaatttagataaagctcttcattcagctggaatagattctggt
ttcataatttttggagctaacctgagtaatccactgaatatgcttttgcctttactacaa
acagttttccctcttgattatattcttataacaattattattatgtactttatttttact
tcaatggcaggaattcgaaatattggcatatggttcttttggattagattatataaaatc
agaagaggtagaaccaggccccaagcactcctttttctctgcatgatacttctgcttatt
gtccttcacactagctacatgatttatagtcttgctccccaatatgttatgtatggaagc
caaaattacttaatagagactaatataacttctgataatcataaaggcaattcaaccctt
tctgtgccaaagagatgtgatgcagatgctcctgaagatcagtgtactgttacccggaca
tacctattccttcacaagttctggttcttcagtgctgcttactattttggtaactgggcc
tttcttggggtatttttgattggattaattgtatcctgttgtaaagggaagaaatcggtt
attgaaggagtagatgaagattcagacataagtgatgatgagccctctgtctattctgct
tga

DBGET integrated database retrieval system